| Clone Name | basd22h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POF13_SCHPO (O94334) F-box protein pof13 | 32 | 1.6 | 2 | CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CH... | 31 | 3.5 | 3 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 30 | 4.6 |
|---|
>POF13_SCHPO (O94334) F-box protein pof13| Length = 396 Score = 32.0 bits (71), Expect = 1.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 148 TLTPVIFGSYLVFRVCLDLVPLAQPAPKQCFTPRCPVNCC 29 TLT ++F+ LD +P P +C RCP+N C Sbjct: 223 TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNAC 262
>CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase)| (Choline acetylase) (ChAT) Length = 748 Score = 30.8 bits (68), Expect = 3.5 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -1 Query: 422 ASL*GGTLPYRCILTSHSFGRSLSPVHLQRKGARSVSYYALFKGWLLLGKPPGCLCTPTS 243 ASL G L Y+ +L SHS + L + YY LF + L G L S Sbjct: 236 ASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNS 295 Query: 242 FI 237 I Sbjct: 296 SI 297
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 493 IQCPENPRFPPQGSSTEGESGPK 561 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,760,057 Number of Sequences: 219361 Number of extensions: 1948866 Number of successful extensions: 4994 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4991 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)