| Clone Name | basd22h01 |
|---|---|
| Clone Library Name | barley_pub |
>GAG_SIVSP (P19504) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 30.4 bits (67), Expect = 2.5 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +1 Query: 220 ETDFLGLGFFEKKRYQGPPPGLSQGIDPFSNEDFPEVEIVIGDPSKFGKSRRSTENQP 393 + FLGLG + KK P + QG+ P + + P V++ + + K G+ +R +P Sbjct: 432 QAGFLGLGPWGKKPRNFPMAQMPQGLTPTAPPEDPAVDL-LKNYMKMGRRQRENRERP 488
>GAG_SIVMK (P05893) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 506 Score = 30.4 bits (67), Expect = 2.5 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +1 Query: 220 ETDFLGLGFFEKKRYQGPPPGLSQGIDPFSNEDFPEVEIVIGDPSKFGKSRRSTENQP 393 + FLGLG + KK P + QG+ P + + P V++ + + + GK +R + +P Sbjct: 431 QAGFLGLGPWGKKPRNFPMAQVHQGLTPTAPPEDPAVDL-LKNYMQLGKQQRESREKP 487
>GAG_SIVS4 (P12496) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +1 Query: 220 ETDFLGLGFFEKKRYQGPPPGLSQGIDPFSNEDFPEVEIVIGDPSKFGKSRRSTENQP 393 + FLGLG + KK P + QG+ P + + P V++ + + K G+ +R +P Sbjct: 432 QAGFLGLGPWGKKPRNFPMAQMPQGLIPTAPPEDPAVDL-LKNYMKMGRKQRENRERP 488
>GAG_SIVM1 (P05894) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 506 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +1 Query: 220 ETDFLGLGFFEKKRYQGPPPGLSQGIDPFSNEDFPEVEIVIGDPSKFGKSRRSTENQP 393 + FLGLG + KK P + QG+ P + + P V++ + + GK +R + +P Sbjct: 431 QAGFLGLGPWGKKPRNFPMAQVHQGLTPTAPPEEPAVDL-LKNYMHLGKQQRESRGKP 487
>GATA4_HUMAN (P43694) Transcription factor GATA-4 (GATA-binding factor 4)| Length = 442 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 6 ASPSAAAFREGVRREQGGLRAGAGVQER-QRGRAG 107 A+ +AAA RE GG AGAG+ R Q GRAG Sbjct: 119 AAAAAAAAREAAAYSSGGGAAGAGLAGREQYGRAG 153
>ARP6_CRYNE (Q5KAQ4) Actin-like protein ARP6| Length = 490 Score = 28.9 bits (63), Expect = 7.3 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +1 Query: 241 GFFEKKRYQGPPPGLSQGIDPFS--NEDFPEVEIVIG-DPSKFGKSRRSTENQPV 396 G F Y PPG S G+D + ++D E+ +G + K GK +R E + V Sbjct: 418 GSFGAPAYNIDPPGFSSGVDARTEVSDDEMEMRYAMGLESKKGGKGKRRKEEEEV 472
>RS3_SYMTH (Q67JU9) 30S ribosomal protein S3| Length = 267 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 6 ASPSAAAFRE--GVRREQGGLRAGAGVQERQRGRAGRRLGSSQSVAAFR 146 A +AA R G RRE+GG R G G RG+ G+R+ + A R Sbjct: 208 AQKAAAGDRRERGERRERGGRRGGRG-----RGQGGQRMSREERAALER 251
>WOX9_ARATH (Q6X7J4) WUSCHEL-related homeobox 9| Length = 378 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = -3 Query: 340 LLSPPRENLHLKKDQFLETALVVDLDNVFSQRNRGPKSR-------SHRMHTLPFSLPFC 182 +++PPRE + + Q E V D + + +NR +S+ +H H+LP + P Sbjct: 74 MVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHKLRLLHNHSKHSLPQTQPQP 133 Query: 181 QMHP 170 Q P Sbjct: 134 QPQP 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.308 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,125,811 Number of Sequences: 219361 Number of extensions: 1278069 Number of successful extensions: 2851 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2850 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)