| Clone Name | basd22d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAF7_SCHPO (O13701) Transcription initiation factor TFIID subuni... | 31 | 3.1 | 2 | MRD1_EMENI (Q5BGA9) Multiple RNA-binding domain-containing prote... | 30 | 4.1 | 3 | CHMO_AMATR (Q93XE1) Choline monooxygenase, chloroplast precursor... | 30 | 5.3 |
|---|
>TAF7_SCHPO (O13701) Transcription initiation factor TFIID subunit 7| (Transcription initiation factor TFIID 55 kDa subunit) (TAFII-55) Length = 393 Score = 30.8 bits (68), Expect = 3.1 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +1 Query: 292 KVGRKTREGTAEPVGVGEAWPSVESDTSEFEFVTSEEDHAENEA 423 ++ + TRE TAEP GE S E + E EE+ ENEA Sbjct: 289 ELSQDTRESTAEPRAAGEESASEEEEEEE------EEEEEENEA 326
>MRD1_EMENI (Q5BGA9) Multiple RNA-binding domain-containing protein 1| Length = 819 Score = 30.4 bits (67), Expect = 4.1 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +1 Query: 271 YRPRKKAKVGRKTREGTAEPVGVGEAWPSVESD--TSEFEFVTSEEDHAENEAPVAE 435 Y RKKAK+G+ E + PV G + ESD S + ED +++APV++ Sbjct: 163 YAQRKKAKLGQDANESSHVPVVAGYQPTTDESDGQPSPEKHEEELEDPQKDQAPVSD 219
>CHMO_AMATR (Q93XE1) Choline monooxygenase, chloroplast precursor (EC| 1.14.15.7) Length = 442 Score = 30.0 bits (66), Expect = 5.3 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 23 IMPQLVPQRLNLGTTWPSGSQQLGANTVRGIVVPGFPRERQG--MARQHVG 169 ++ ++V QR+ + P+G +LG+ + P F ER G M H+G Sbjct: 311 LLEKVVIQRVASSSNKPNGFDRLGSEAFYAFIYPNFAVERYGPWMTTMHIG 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.126 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,887,886 Number of Sequences: 219361 Number of extensions: 1259882 Number of successful extensions: 2225 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2225 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)