| Clone Name | basd22d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BSP1_CANGA (Q6FQG3) Protein BSP1 | 31 | 2.7 | 2 | DUS11_HUMAN (O75319) RNA/RNP complex-1-interacting phosphatase (... | 31 | 3.5 | 3 | YM67_YEAST (Q03661) Hypothetical 187.1 kDa protein in GUA1-ERG8 ... | 30 | 4.6 | 4 | PLB3_CANAL (Q9UVX1) Lysophospholipase 3 precursor (EC 3.1.1.5) (... | 30 | 7.9 | 5 | K2C8_XENLA (P08776) Keratin, type II cytoskeletal 8 (Cytokeratin... | 30 | 7.9 |
|---|
>BSP1_CANGA (Q6FQG3) Protein BSP1| Length = 525 Score = 31.2 bits (69), Expect = 2.7 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = -3 Query: 495 EMLDKYEKLNRKYPP-PKFEXXXXXXXXXXXRVYPDNSTEEVTQR-NSNRGEPEDARSMN 322 E +D KLN+K PP P+ + + NST E Q+ N E D+ + Sbjct: 399 ESIDMLPKLNKKGPPVPQRKVSMPEALKKLESMKNKNSTTENVQKDNGEESEISDSEPES 458 Query: 321 LDNELEETPKTSLDRNVLGDAASG 250 ++N+LE K + +G G Sbjct: 459 INNKLESVLKRANTSGQIGSKHIG 482
>DUS11_HUMAN (O75319) RNA/RNP complex-1-interacting phosphatase (EC 3.1.3.-)| (Phosphatase that interacts with RNA/RNP complex 1) (Dual-specificity protein phosphatase 11) Length = 330 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 58 DAARHSKDRRRLYPYHYWEISIP 126 +A+R ++DRRR YPY+Y +S P Sbjct: 301 NASRAAQDRRRWYPYNYSRLSYP 323
>YM67_YEAST (Q03661) Hypothetical 187.1 kDa protein in GUA1-ERG8 intergenic| region Length = 1658 Score = 30.4 bits (67), Expect = 4.6 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 12/62 (19%) Frame = -3 Query: 393 DNSTEEVTQRNSNRGEPEDARSMNLDNELEETPKTSLDR------------NVLGDAASG 250 D STE VT N N G+ +S N T K++ D NV GD++ Sbjct: 780 DESTENVTFENENTGDENKNQSKNFPGVANSTDKSTEDNTDEKYFSAINYTNVTGDSSCE 839 Query: 249 DV 244 D+ Sbjct: 840 DI 841
>PLB3_CANAL (Q9UVX1) Lysophospholipase 3 precursor (EC 3.1.1.5) (Phospholipase| B 3) Length = 754 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +2 Query: 449 GGGYFLFNFSYLSNISSFINTSPSILTIEVSGRTPSSSISAKTSNIFSYDP 601 G G +S + N+SSF + S + +GRTP + I + S IF P Sbjct: 312 GTGGANITWSSIRNLSSFQDHSMPYPIVVANGRTPGTYIINENSTIFEISP 362
>K2C8_XENLA (P08776) Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8)| (Keratin-8) (K8) Length = 502 Score = 29.6 bits (65), Expect = 7.9 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 6/57 (10%) Frame = +2 Query: 440 SNFGGGY---FLFNFSYLSNISSFI---NTSPSILTIEVSGRTPSSSISAKTSNIFS 592 S FGGGY + +SY SN+SS+I TS L ++ + T + +++S++FS Sbjct: 445 SGFGGGYGGGYGGGYSYSSNVSSYIGDTKTSKRRLLVK-TVETKDGRVLSESSDVFS 500 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,521,419 Number of Sequences: 219361 Number of extensions: 2069441 Number of successful extensions: 5351 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5351 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)