| Clone Name | basd22b19 |
|---|---|
| Clone Library Name | barley_pub |
>THN5_HORVU (P09617) Leaf-specific thionin precursor [Contains: Leaf-specific| thionin; Acidic protein] Length = 137 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +3 Query: 69 MLTGTTTLKAIMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 M T + ++C+LIL + + CC + + C AC AGGS +C C Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEAKSCCKNTTGRNCYNACRFAGGSRPVCATAC 58
>THNX_HORVU (Q8H0Q5) Probable leaf thionin precursor [Contains: Probable leaf| thionin; Acidic protein] Length = 137 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +3 Query: 69 MLTGTTTLKAIMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 M T + ++C+LIL + + CC + + C AC AGGS +C C Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEGKSCCKNTTGRNCYNACHFAGGSRPVCATAC 58
>THN7_HORVU (Q42838) Thionin BTH7 precursor [Contains: Thionin BTH7; Acidic| protein] Length = 137 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +3 Query: 69 MLTGTTTLKAIMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 M T + ++C+LIL + + CC + + C AC AGGS +C C Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEGKSCCKNTTGRNCYNACRFAGGSRPVCATAC 58
>THN3_HORVU (P08772) Leaf-specific thionin DB4 precursor [Contains:| Leaf-specific thionin DB4; Acidic protein] Length = 137 Score = 37.4 bits (85), Expect = 0.025 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 99 IMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 ++C+LIL + + CC A+ C C AGGS +C C Sbjct: 11 VICVLILGLVLEQVQVEGKSCCKDTLARNCYNTCHFAGGSRPVCAGAC 58
>THN6_HORVU (P09618) Leaf-specific thionin BTH6 precursor [Contains:| Leaf-specific thionin BTH6; Acidic protein] Length = 137 Score = 36.6 bits (83), Expect = 0.043 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 99 IMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 ++C+LIL + + CC A+ C C AGGS +C C Sbjct: 11 VICVLILVLVLEQVQVEGKSCCKDTLARNCYNTCRFAGGSRPVCAGAC 58
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 35.8 bits (81), Expect = 0.074 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 CG C +++ C C ++G + C+++CC PC S Sbjct: 108 CGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCCQSS 146 Score = 31.6 bits (70), Expect = 1.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 153 CG--CCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 CG CC S+ K CC C ++ C+++CC PC Sbjct: 128 CGSSCCQSSCCKPCC--CQSSCCVPVCCQSSCCKPC 161
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 35.4 bits (80), Expect = 0.096 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 CG C ++ CC C + G + C+++CC PC S Sbjct: 134 CGSCGCSQCN-CCKPCCCSSGCGSCCQSSCCNPCCCQSS 171 Score = 30.4 bits (67), Expect = 3.1 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 153 CG-CCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 CG CC S+ CC C ++ C+++CC PC S Sbjct: 154 CGSCCQSSCCNPCC--CQSSCCVPVCCQSSCCKPCCCQSS 191
>THNB_WHEAT (P01543) Purothionin A-1 precursor (Purothionin A-I)| (Beta-purothionin) [Contains: Purothionin A-1; Acidic protein] Length = 136 Score = 35.4 bits (80), Expect = 0.096 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 78 GTTTLKAIM-CLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 G+ LK +M CLLIL + + CC S + C C A G+ +C N C Sbjct: 2 GSKGLKGVMVCLLILGLVLEQVQVEGKSCCKSTLGRNCYNLC-RARGAQKLCANVC 56
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 35.4 bits (80), Expect = 0.096 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCF-ACIAAGGSDTICKNTCCFPCILA 263 ST Q CCVS+ + CC AC +T C+ TCC P L+ Sbjct: 34 STPCCQPSCCVSSCCQPCCRPACC----QNTCCRTTCCQPTCLS 73 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +3 Query: 132 HSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 248 + TT GC + +CC C +T C T CF Sbjct: 102 YPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCF 140
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 35.0 bits (79), Expect = 0.13 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 CG C ++ C C ++G + C+++CC PC Sbjct: 191 CGSCGCSQCSCCKPCCCSSGCGSSCCQSSCCKPC 224 Score = 32.3 bits (72), Expect = 0.81 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 159 CCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 CC S+ K CC + +G + C+++CC PC Sbjct: 244 CCQSSCCKPCCSS---SGCGSSCCQSSCCNPC 272 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 11/50 (22%) Frame = +3 Query: 135 STTAAQCGCCV----------SARAKACCFACIAAGG-SDTICKNTCCFP 251 S +QC CC S +CC C ++ G + C+++CC P Sbjct: 193 SCGCSQCSCCKPCCCSSGCGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKP 242
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 35.0 bits (79), Expect = 0.13 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 11/47 (23%) Frame = +3 Query: 147 AQCGCCV-----SARAKACCFA------CIAAGGSDTICKNTCCFPC 254 +QC CC S R +CC + C ++G + C+++CC PC Sbjct: 107 SQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPC 153 Score = 35.0 bits (79), Expect = 0.13 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 138 TTAAQCGCC--VSARAKACCFACIAAGGSDTICKNTCCFPC 254 ++ QC CC ++ C C ++G + C+++CC PC Sbjct: 94 SSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPC 134 Score = 30.0 bits (66), Expect = 4.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 CG C ++ C C ++G + C+ +CC P Sbjct: 72 CGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKP 104
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 34.7 bits (78), Expect = 0.16 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 ST Q CCVS+ + CC T C+NTCC P Sbjct: 34 STPCCQPSCCVSSCCQPCC--------RPTCCQNTCCQP 64
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 34.7 bits (78), Expect = 0.16 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 9/43 (20%) Frame = +3 Query: 153 CG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFPC 254 CG CC S+ K CC C ++G + C+++CC PC Sbjct: 129 CGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 171 Score = 32.0 bits (71), Expect = 1.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 CGC + K CC ++G + C+++CC PC Sbjct: 83 CGCSQCSCYKPCC---CSSGCGSSCCQSSCCKPC 113 Score = 30.8 bits (68), Expect = 2.4 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 10/44 (22%) Frame = +3 Query: 153 CG--CCVSARAKACCF--------ACIAAGGSDTICKNTCCFPC 254 CG CC S+ K CC +C + GS + C+++CC PC Sbjct: 100 CGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGS-SCCQSSCCKPC 142
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 34.7 bits (78), Expect = 0.16 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 9/43 (20%) Frame = +3 Query: 153 CG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFPC 254 CG CC S+ K CC C ++G + C+++CC PC Sbjct: 180 CGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 222 Score = 31.6 bits (70), Expect = 1.4 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 141 TAAQCGCCVSARAKACCF--ACIAAGGSDTICKNTCCFPC 254 + +Q CC +++ C C ++G + C+++CC PC Sbjct: 154 SCSQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 193 Score = 30.8 bits (68), Expect = 2.4 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +3 Query: 99 IMCLLILSIAVHSTTAAQCGCC-----VSARAKACCFACIAAGGSDTICKNTCCFPCILA 263 + C + V + + + CG C V C C + GGS C ++CC P + Sbjct: 39 VCCCKPVCCCVPACSCSSCGSCGGSKGVCGSCGGCKGGCGSCGGSKGGCGSSCCVPVCCS 98 Query: 264 DS 269 S Sbjct: 99 SS 100
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 34.7 bits (78), Expect = 0.16 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 9/43 (20%) Frame = +3 Query: 153 CG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFPC 254 CG CC S+ K CC C ++G + C+++CC PC Sbjct: 107 CGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPC 149 Score = 32.3 bits (72), Expect = 0.81 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 CGC + K CC ++G + C+++CC PC S Sbjct: 90 CGCSQCSCYKPCC---CSSGCGSSCCQSSCCKPCCCQSS 125
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 34.7 bits (78), Expect = 0.16 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 ST Q CCVS+ + CC T C+NTCC P Sbjct: 29 STPCCQPSCCVSSCCQPCC--------RPTCCQNTCCQP 59 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +3 Query: 132 HSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 248 H TT GC + +CC C +T C T CF Sbjct: 107 HPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCF 145
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 34.3 bits (77), Expect = 0.21 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 ST Q CCVS+ + CC +T C+ TCC P Sbjct: 29 STPCCQPSCCVSSCCQPCCHPTCC---QNTCCRTTCCQP 64
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 33.9 bits (76), Expect = 0.28 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 ST+ Q CCVS+ + CC +T C+ TCC P Sbjct: 34 STSCCQPACCVSSCCQPCCRPTSC---QNTCCRTTCCQP 69
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 33.1 bits (74), Expect = 0.48 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 138 TTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 ++ +QC CC K CC ++G + C+++CC PC Sbjct: 232 SSCSQCSCC-----KPCC---CSSGCGSSCCQSSCCKPC 262
>THNB_HORVU (P21742) Beta-hordothionin precursor [Contains: Beta-hordothionin;| Acidic protein] Length = 136 Score = 33.1 bits (74), Expect = 0.48 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 78 GTTTLKAIM-CLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 G+ LK +M CLLIL + + CC S + C C G+ +C N C Sbjct: 2 GSKGLKGVMVCLLILGLVLEHVQVEGKSCCRSTLGRNCYNLC-RVRGAQKLCANAC 56
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 32.7 bits (73), Expect = 0.62 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 +++ Q CCV +K+ C+ + +G S + C+ + C P Sbjct: 138 TSSPCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQP 176
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 32.7 bits (73), Expect = 0.62 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 +++ +Q GCCV K C + +G S + C+ + C P S Sbjct: 257 TSSQSQQGCCVPVCCKPVCCVPVCSGASTSCCQQSSCQPACCTTS 301 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%) Frame = +3 Query: 81 TTTLKAIMCLLILS--IAVHSTTAAQCGCCVSARA-KACC--FAC--IAAGGSDTICKNT 239 T K + C+ + S + ++ Q CC S+ +ACC C + +G S + C+ + Sbjct: 117 TVCCKPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQS 176 Query: 240 CCFPCI 257 C C+ Sbjct: 177 SCVSCV 182
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 31.6 bits (70), Expect = 1.4 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGG-SDTICKNTCCFPC 254 CG C ++ +CC C + G + C+++CC PC Sbjct: 80 CGSCGCSQC-SCCKPCYCSSGCGSSCCQSSCCKPC 113
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 Query: 141 TAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 ++ Q CC S+ + C C+ CK CC P DS Sbjct: 93 SSCQLACCASSPCQQAC--CVPVCCKTVCCKPVCCVPVCCGDS 133 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 +++ +Q GCCV K + +G S + C+ + C P S Sbjct: 309 TSSQSQQGCCVPVCCKPVSCVPVCSGASSSCCQQSSCQPACCTTS 353
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 30.8 bits (68), Expect = 2.4 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +3 Query: 141 TAAQCG--CCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 +++ CG CC S+ +K CC + C+++CC PC S Sbjct: 93 SSSGCGSFCCQSSCSKPCCC-------QSSCCQSSCCKPCCCQSS 130 Score = 30.4 bits (67), Expect = 3.1 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 CG C +++ C C ++G C+++C PC S Sbjct: 77 CGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSS 115
>KR412_HUMAN (Q9BQ66) Keratin-associated protein 4-12 (Keratin-associated| protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) Length = 201 Score = 30.8 bits (68), Expect = 2.4 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 13/52 (25%) Frame = +3 Query: 138 TTAAQCGCCVSARAK-----------ACC--FACIAAGGSDTICKNTCCFPC 254 TT + CCVS+ + CC CI++ + C+++CC PC Sbjct: 113 TTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSSCCPSCCESSCCRPC 164
>YDC9_SCHPO (Q10172) Hypothetical protein C25G10.09c in chromosome I| Length = 1794 Score = 30.8 bits (68), Expect = 2.4 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = -3 Query: 316 PSMATLAPISSILATTESARIQGKQQVFLHIVSEPPAAIQAKQHAFARALTQQP 155 PS+A P S AT S+ + Q F H+ S P A QH A AL+ P Sbjct: 1499 PSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSPAP---PAPQHPSAAALSSAP 1549
>THN2_WHEAT (P32032) Alpha-2-purothionin precursor [Contains:| Alpha-2-purothionin; Acidic protein] Length = 136 Score = 30.8 bits (68), Expect = 2.4 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 78 GTTTLKAIM-CLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 G+ LK +M CLLIL + + CC + + C C + G+ +C C Sbjct: 2 GSKGLKGVMVCLLILGLVLEQVQVEGKSCCRTTLGRNCYNLC-RSRGAQKLCSTVC 56
>SCRT2_MOUSE (Q8BTH6) Transcriptional repressor scratch 2 (Scratch homolog 2| zinc finger protein) Length = 311 Score = 30.4 bits (67), Expect = 3.1 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 13/68 (19%) Frame = +2 Query: 101 HVPAH-IEHRCSLDHR--STVWLL----RKRPGKSMLLCLYC------RRWLRHNMQEHL 241 HV H + H+C + + S WLL R G+ C +C R LR +MQ H Sbjct: 210 HVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHS 269 Query: 242 LFPLYSCR 265 F Y CR Sbjct: 270 AFKHYRCR 277
>NPT1_RABIT (Q28722) Renal sodium-dependent phosphate transport protein 1| (Sodium/phosphate cotransporter 1) (Na(+)/PI cotransporter 1) (Renal sodium-phosphate transport protein 1) (Renal Na(+)-dependent phosphate cotransporter 1) (Solute carrier family 1 Length = 465 Score = 30.4 bits (67), Expect = 3.1 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = -3 Query: 151 CAAVVE*TAMLNMSRHMIAF----KVVVPVSILLPSIVSFCCCYLS 26 C + TA MSR+M++ K+ + +LLP + S C YLS Sbjct: 312 CGVIAGHTADFLMSRNMLSLTAIRKLFTAIGLLLPIVFSMCLLYLS 357
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 30.4 bits (67), Expect = 3.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 141 TAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 T + CC+S+ + C CI++ + C+ TCC P Sbjct: 1 TCCRPSCCISSCCRPSC--CISSCCKPSCCQTTCCRP 35
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +3 Query: 135 STTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 +++++Q CCV K C+ + S + C+ + C P S Sbjct: 133 ASSSSQQSCCVPVCCKPVCYVPTCSESSSSCCQQSSCHPACCTSS 177
>ASPM_FELCA (P62288) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3461 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 306 RHWLPFLPS*QQPNRQEYRGNNKCSCILCRSHLRQYKQSNMLL 178 RHWL +L + R E K SC++ +S R++KQ M L Sbjct: 1403 RHWLAYLRRKRDQQRYEML---KSSCLIIQSVFRRWKQHKMRL 1442
>THAB_PAROL (Q91242) Thyroid hormone receptor alpha B (THR-alpha-B)| Length = 391 Score = 29.6 bits (65), Expect = 5.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 188 LLCLYCRRWLRHNMQEHLLFPLYSCRFGCC 277 + C C+ + R +Q++L P YSC++ CC Sbjct: 48 ITCEGCKGFFRRTIQKNL-HPSYSCKYDCC 76
>DACT1_MOUSE (Q8R4A3) Dapper homolog 1 (MDpr1) (Frodo) (Thymus-expressed novel| gene 3 protein) Length = 778 Score = 29.3 bits (64), Expect = 6.9 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -2 Query: 296 SHFFHLSNNRIGKNTGETTSVLAYCVGATCGNTSKATCFCPGAYAAATLCCGGRVNSD 123 S F+ LS+ G + + SV + C+ + +TCFC AA T+ G ++D Sbjct: 152 SGFYELSDGASGSLSNSSNSVFSECLSSC----HSSTCFCSPLEAALTISDGCPKSAD 205
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +3 Query: 138 TTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 269 ++ Q CCV K C + +G S C+ + C P S Sbjct: 144 SSPCQQSCCVPVCCKPICCVPVCSGASSLCCQQSSCQPACCTTS 187
>THN24_ARATH (Q9C8D6) Probable thionin-2.4 precursor [Contains: Probable| thionin-2.4; Acidic protein] Length = 134 Score = 29.3 bits (64), Expect = 6.9 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +3 Query: 54 MEGKRMLTGTTTLKAIMCLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTIC- 230 MEGK + I+ +LI+S+ + CC S +A+ AC+ A GS + C Sbjct: 1 MEGKTL---------IVSVLIMSLFMAQNQVDANICCPSIQARTFYNACLFAVGSPSSCI 51 Query: 231 KNTCC 245 +N+ C Sbjct: 52 RNSSC 56
>SCRT2_HUMAN (Q9NQ03) Transcriptional repressor scratch 2 (Scratch homolog 2| zinc finger protein) Length = 307 Score = 29.3 bits (64), Expect = 6.9 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 13/68 (19%) Frame = +2 Query: 101 HVPAH-IEHRCSLDHR--STVWLL----RKRPGKSMLLCLYC------RRWLRHNMQEHL 241 H+ H + H+C + + S WLL R G+ C +C R LR +MQ H Sbjct: 204 HLLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHS 263 Query: 242 LFPLYSCR 265 F Y CR Sbjct: 264 AFKHYRCR 271
>MTCD_TETTH (Q8WSW3) Cadmium metallothionein precursor (MT-Cd) (Cd-MT)| Length = 162 Score = 29.3 bits (64), Expect = 6.9 Identities = 13/39 (33%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = +3 Query: 150 QCGCCVSARAKACCF----ACIAAGGSDTICKN---TCC 245 Q CC AK CCF C ++ CK+ CC Sbjct: 60 QANCCCGVNAKPCCFDPNSGCCCVSKTNNCCKSDTKECC 98
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 29.3 bits (64), Expect = 6.9 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 138 TTAAQCGCCVSARAKA-CCFACIAAGGSDTICKNTCCFPCILADS 269 TT + CCVS+ + CC T C+ TCC P S Sbjct: 33 TTCCRPSCCVSSCCRPQCC--------QTTCCRTTCCHPSCCVSS 69
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +3 Query: 141 TAAQCGCCVSARAK-ACCFACIAAGGSDT------ICKNTCCFP 251 + A CC + + ACC A S +CK+TCC P Sbjct: 276 SGASTSCCQQSSCQPACCTASCCRSSSSVSLLCHPVCKSTCCVP 319 Score = 29.3 bits (64), Expect = 6.9 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +3 Query: 141 TAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 ++ Q CC S+ + C + +G S + C+ + C P Sbjct: 254 SSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQP 290
>SCX8_CENSC (Q95WD1) Neurotoxin 8 precursor (CsE8)| Length = 85 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 129 VHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 248 VH T + C S C C + GG IC++ C+ Sbjct: 25 VHEDTGCRYKCTFSGENSYCDKECKSQGGDSGICQSKACY 64
>RNZ2_MOUSE (Q80Y81) Zinc phosphodiesterase ELAC protein 2 (EC 3.1.26.11)| (Ribonuclease Z 2) (RNase Z 2) (tRNase Z 2) (tRNA 3 endonuclease 2) (ElaC homolog protein 2) Length = 831 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 275 C*DGRNGSQCRHGRRRIK*YACTATSMDAIHMHMMHCFKLWSSYVNVYLQ 424 C +G G CRH ++I C+ T++ H+H H + +N+ LQ Sbjct: 512 CGEGTFGQLCRHYGQQIDRVLCSLTAVFVSHLHADH----HTGLLNILLQ 557
>ECAP_LYCES (Q42883) Calcium-transporting ATPase, endoplasmic reticulum-type| (EC 3.6.3.8) Length = 1048 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 270 VVAKMEEMGANVAMEGEE*NDTPALLL 350 +V ++EMG VAM G+ ND PAL L Sbjct: 712 IVRMLKEMGEIVAMTGDGVNDAPALKL 738
>KRA95_HUMAN (Q9BYQ1) Keratin-associated protein 9-5 (Keratin-associated protein| 9.5) (Ultrahigh sulfur keratin-associated protein 9.5) (Fragment) Length = 111 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +3 Query: 132 HSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 248 + TT GC + +CC C +T C T CF Sbjct: 59 YPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCF 97
>THN1_WHEAT (P01544) Alpha-1-purothionin precursor (Purothionin A-II)| [Contains: Alpha-1-purothionin; Acidic protein] (Fragment) Length = 126 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 105 CLLILSIAVHSTTAAQCGCCVSARAKACCFACIAAGGSDTICKNTC 242 CLLIL + + CC S + C C A G+ +C C Sbjct: 1 CLLILGLVLEQLQVEGKSCCRSTLGRNCYNLC-RARGAQKLCAGVC 45
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 147 AQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 251 +QC CC K CC ++G + C+++CC P Sbjct: 149 SQCSCC-----KPCC---CSSGCGSSCCQSSCCKP 175
>ECA2_ARATH (O23087) Calcium-transporting ATPase 2, endoplasmic reticulum-type| (EC 3.6.3.8) Length = 1054 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 270 VVAKMEEMGANVAMEGEE*NDTPALLL 350 +V ++EMG VAM G+ ND PAL L Sbjct: 711 IVRMLKEMGEIVAMTGDGVNDAPALKL 737
>AGI_ORYSA (P11219) Lectin precursor (Agglutinin) [Contains: Lectin 10 kDa| peptide; Lectin 8 kDa peptide] Length = 227 Score = 28.9 bits (63), Expect = 9.0 Identities = 24/87 (27%), Positives = 32/87 (36%), Gaps = 29/87 (33%) Frame = +3 Query: 72 LTGTTTLKAIMCLLILSIAVHSTTAAQ-CG------------CC--------------VS 170 +T TTT M +L+ A + T AQ CG CC Sbjct: 3 MTSTTTKAMAMAAAVLAAAAVAATNAQTCGKQNDGMICPHNLCCSQFGYCGLGRDYCGTG 62 Query: 171 ARAKACCFA--CIAAGGSDTICKNTCC 245 ++ ACC + C + GG T N CC Sbjct: 63 CQSGACCSSQRCGSQGGGATCSNNQCC 89
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 8/52 (15%) Frame = +3 Query: 138 TTAAQCGCCVSARAK------ACC--FACIAAGGSDTICKNTCCFPCILADS 269 TT + CCVS+ + CC C + T C+ TCC P S Sbjct: 33 TTCCRPSCCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSS 84
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/40 (32%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 159 CCVSARAKACCF---ACIAAGGSDTICKNTCCFPCILADS 269 CC S+ + CC C T C+ TCC P S Sbjct: 70 CCESSCCRPCCCRPSCCQTTCCRTTCCRTTCCCPSCCVSS 109
>MT4_MOUSE (P47945) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCC 245 C CC AK C CI GGSD K +CC Sbjct: 35 CPCCPPGCAK-CARGCICKGGSD---KCSCC 61
>MT4_HUMAN (P47944) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCC 245 C CC AK C CI GGSD K +CC Sbjct: 35 CPCCPPGCAK-CARGCICKGGSD---KCSCC 61
>MT4_CANFA (Q9TUI5) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCC 245 C CC AK C CI GGSD K +CC Sbjct: 35 CPCCPPGCAK-CAQGCICKGGSD---KCSCC 61
>MT2C_RABIT (P80290) Metallothionein-2C (MT-2C) (Metallothionein-IIC) (MT-IIC)| Length = 62 Score = 28.9 bits (63), Expect = 9.0 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 C C + + C +C T CK +CC C Sbjct: 5 CSCATAGDSCTCANSCTCKACKCTSCKKSCCSCC 38
>MT2A_RABIT (P18055) Metallothionein-2A (MT-2A) (Metallothionein-IIA) (MT-IIA)| Length = 62 Score = 28.9 bits (63), Expect = 9.0 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +3 Query: 153 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 254 C C + + C +C T CK +CC C Sbjct: 5 CSCAAAGDSCTCANSCTCKACKCTSCKKSCCSCC 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,236,050 Number of Sequences: 219361 Number of extensions: 1864627 Number of successful extensions: 5632 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 5205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5584 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)