ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd21m15 |
|---|---|
| Clone Library Name | barley_pub |
>Y1706_HAEIN (P45335) Probable transport protein HI1706| Length = 669 Score = 33.9 bits (76), Expect = 0.096 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 236 QVLMHLLFHYHLNCLVVAGPWAVVLTFLDFFYQVLLSYLSSFFCLNHEHTN 388 + L+H LFH+ ++ V G A+ L + F Y++ L+ S F+ L + N Sbjct: 130 EALLHTLFHWGIHAWAVYGTIALALAYFGFRYKLPLALRSCFYPLLKDRIN 180
>SWC4_YARLI (Q6C9M6) SWR1-complex protein 4| Length = 504 Score = 30.8 bits (68), Expect = 0.81 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = -2 Query: 248 ASTPAPRHIFVMPELIDLNKLTQDPSKRKQVADYHPSQRDEMRKRI-----*SGGLISCT 84 AS+ R + +P+L +KLTQ P ++K A + D M++ + + +S T Sbjct: 2 ASSSDVRDVLDLPDLEPNDKLTQQPKRQKLAAPVGGKRMDGMQRELFALMGENTPSVSVT 61 Query: 83 LTFHTSRLSDK 51 HTS DK Sbjct: 62 KDSHTSLFKDK 72
>NOF_DROME (P16320) 120.7 kDa protein in NOF-FB transposable element| Length = 1056 Score = 30.8 bits (68), Expect = 0.81 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 176 PSKRKQVADYHPSQRDEMRKRI*SGGLISCTLTFHTSRLSDKIDDDYL 33 P K ++ P+ D M K I + C F ++LSDK+D+ +L Sbjct: 125 PKKDQKTEKLQPNWTDTMAKLIYKKVPLPCAFNFRKAKLSDKVDNIWL 172
>IGA4_HAEIN (P45386) Immunoglobulin A1 protease precursor (EC 3.4.21.72) (IGA1| protease) Length = 1849 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Frame = -2 Query: 374 DLNRKKKKDSLG-----VLDKKNQEMSTPLPRGLPLLNNS 270 D K K S+G V DKKNQ + + LP G+P+++ S Sbjct: 39 DFAENKGKFSVGATNVEVRDKKNQSLGSALPNGIPMIDFS 78
>CAR11_HUMAN (Q9BXL7) Caspase recruitment domain-containing protein 11| (CARD-containing MAGUK protein 3) (Carma 1) Length = 1147 Score = 29.6 bits (65), Expect = 1.8 Identities = 22/68 (32%), Positives = 27/68 (39%) Frame = -2 Query: 335 LDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNKLTQDPSKRKQV 156 L K + + LPR LP+ S D GDAS E D + + P K Sbjct: 431 LSKDSNNLDQSLPRNLPVTIISQD--FGDASPRTNGQ-----EADDSSTSEESPEDSKYF 483 Query: 155 ADYHPSQR 132 YHP QR Sbjct: 484 LPYHPPQR 491
>TPP1_MACFA (Q60HH1) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) Length = 563 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ ++DSL + + N E+ RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDEEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSV-SGRHQF 374
>TPP1_PONPY (Q5RFL1) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) Length = 564 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ ++DSL + + N E+ RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDEEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSV-SGRHQF 374
>TRMB_CAEEL (Q23126) Probable tRNA (guanine-N(7)-)-methyltransferase (EC| 2.1.1.33) (tRNA(m7G46)-methyltransferase) Length = 256 Score = 29.3 bits (64), Expect = 2.4 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 7/86 (8%) Frame = -3 Query: 376 MI*TEKRRKIA*EYLIKKIKKCQHHCPGACHY*TIQVIVE*EM-------HQHLHQDIFL 218 MI E R K++ +Y+ +KI+ + H A HY + V+ M H+ +F Sbjct: 93 MIGMEIRVKVS-DYVNEKIQALRKHHAEAGHYRNVAVLRSNAMKYMPNYFHKGQLSKMFF 151 Query: 217 LCPN*LI*TSLPRIHLKGSKWQIITP 140 L P+ P K KW+IITP Sbjct: 152 LFPD-------PHFKNKKHKWRIITP 170
>MQO_WOLSU (Q7MBG6) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 497 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 154 ATCFLLDGSWVSLFKSISSGITKICLGAGVDASPI 258 +T FL GS++ F S +SG K + AG+D P+ Sbjct: 321 STNFLKQGSYLDFFLSFNSGNFKTMIEAGLDNIPL 355
>PECA1_BOVIN (P51866) Platelet endothelial cell adhesion molecule precursor| (PECAM-1) (CD31 antigen) Length = 739 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 317 EMSTPLPRGLPLLNNSSDSGIGDASTPAPRH 225 EMS P +PLLN++++ + DA T A RH Sbjct: 634 EMSRP---AVPLLNSNNEKTLSDAGTEADRH 661
>TPP1_PANTR (Q5IS74) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) Length = 563 Score = 28.5 bits (62), Expect = 4.0 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ +DSL + + N E+ RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSV-SGRHQF 374
>TPP1_HUMAN (O14773) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) (Lysosomal pepstatin insensitive protease) (LPIC) (Growth-inhibiting gene 1 protein) Length = 563 Score = 28.5 bits (62), Expect = 4.0 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ +DSL + + N E+ RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSV-SGRHQF 374
>TPP1_BOVIN (Q71JP6) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) Length = 563 Score = 28.5 bits (62), Expect = 4.0 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ +DSL + + N E+ RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSV-SGRHQF 374
>PBPA_XYLFT (Q87AW7) Penicillin-binding protein 1A (PBP-1a) (PBP1a) [Includes:| Penicillin-insensitive transglycosylase (EC 2.4.2.-) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3.4.-.-) (DD-transpeptidase)] Length = 809 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 293 GLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNKLTQDPSKRKQVADYH 144 G+P +S + A R ++V+ ++DLN +TQD + + H Sbjct: 206 GIPKFPSSGNPITNPARARERRDLYVLQRMVDLNFITQDQANAAKAIPMH 255
>PBPA_XYLFA (Q9PGD4) Penicillin-binding protein 1A (PBP-1a) (PBP1a) [Includes:| Penicillin-insensitive transglycosylase (EC 2.4.2.-) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3.4.-.-) (DD-transpeptidase)] Length = 809 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 293 GLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNKLTQDPSKRKQVADYH 144 G+P +S + A R ++V+ ++DLN +TQD + + H Sbjct: 206 GIPKFPSSGNPITNPARARERRDLYVLQRMVDLNFITQDQANAAKAIPMH 255
>HEX_ADE06 (Q04966) Hexon protein (Late protein 2) (Fragment)| Length = 465 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +3 Query: 111 NTFSHL--ITLAGVIICHL-LPFRWILGKLVQIN*FGHNKN 224 NT+ H+ + G++ C++ L RW L + +N F H++N Sbjct: 391 NTYDHMKRVVAPGLVDCYINLGARWSLDYMDNVNPFNHHRN 431
>CH601_STRAL (Q00767) 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL protein 1)| (HSP58) Length = 539 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 196 KSISSGITKICLGAGVDASPIPLSLELFSSGRPLGSGVDI 315 +++++G + L G+DA+ +S EL + RP+ DI Sbjct: 103 RNVAAGASPAALKKGIDAAVAAVSAELLDTARPIDDKSDI 142
>BCSB_XANAC (P58933) Cyclic di-GMP-binding protein precursor (Cellulose| synthase regulatory subunit) Length = 788 Score = 28.5 bits (62), Expect = 4.0 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 6/74 (8%) Frame = -2 Query: 344 LGVLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNK------LT 183 LG + Q +T L PL + + IGD S PAPR + P + + L Sbjct: 322 LGRNSEDLQRAATALALRAPL--TGAVARIGDISAPAPRRPYDAPSWVSSERPVRFGDLV 379 Query: 182 QDPSKRKQVADYHP 141 PS + VA YHP Sbjct: 380 TQPS-QLNVAGYHP 392
>MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 524 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 163 FLLDGSWVSLFKSISSGITKICLGAGVDASPI 258 FL GSW+ LF S++ K + AG+D P+ Sbjct: 341 FLKYGSWLDLFHSLNKHNLKPIIQAGIDNFPL 372
>OXSM_MOUSE (Q9D404) 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial| precursor (EC 2.3.1.41) (Beta-ketoacyl synthase) Length = 459 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 193 FKSISSGITKICLGAGVDASPIPLSLELFSSGRPLGSGVD 312 F+ I+ G + + G D+ PLSL FS R L S D Sbjct: 220 FRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSSNPD 259
>CH601_STRAW (Q82DI5) 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL1 protein)| Length = 541 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 196 KSISSGITKICLGAGVDASPIPLSLELFSSGRPLGSGVDI 315 K++++G + L G+DA+ +S EL ++ RP+ DI Sbjct: 103 KNVAAGASPALLKKGIDAAVKAVSEELLATARPIDEKSDI 142
>TPP1_CANFA (Q9XSB8) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) (Lysosomal pepstatin insensitive protease) (LPIC) Length = 563 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -2 Query: 383 YVHDLNRKKKKDSLG--VLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIF 219 +VH ++ +DSL + + N E RGL LL S DSG G S + RH F Sbjct: 319 HVHTVSYGDDEDSLSSAYIQRVNTEFMKAAARGLTLLFASGDSGAGCWSV-SRRHQF 374
>CH601_STRLI (O33659) 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL1 protein)| Length = 540 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 196 KSISSGITKICLGAGVDASPIPLSLELFSSGRPLGSGVDI 315 K++++G + L G+DA+ +S +L ++ RP+ DI Sbjct: 102 KNVAAGASPALLKKGIDAAVAAVSEDLLATARPIDEKSDI 141
>CH601_STRCO (P40171) 60 kDa chaperonin 1 (Protein Cpn60 1) (groEL1 protein)| (HSP58) Length = 540 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 196 KSISSGITKICLGAGVDASPIPLSLELFSSGRPLGSGVDI 315 K++++G + L G+DA+ +S +L ++ RP+ DI Sbjct: 103 KNVAAGASPALLKKGIDAAVAAVSEDLLATARPIDEKSDI 142
>T7L1D_XENLA (P70064) Transcription factor 7-like 1-D (HMG box transcription| factor 3-D) (TCF-3-D) (xTcf-3d) Length = 550 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 287 PLLNNSSDSGIGDASTPAPRHI 222 PLL++ S +G+ DA +P+P H+ Sbjct: 131 PLLDSPSTAGLKDARSPSPAHL 152
>T7L1C_XENLA (P70063) Transcription factor 7-like 1-C (HMG box transcription| factor 3-C) (TCF-3-C) (xTcf-3c) Length = 550 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 287 PLLNNSSDSGIGDASTPAPRHI 222 PLL++ S +G+ DA +P+P H+ Sbjct: 131 PLLDSPSTAGLKDARSPSPAHL 152
>TF7L1_XENTR (Q6GL68) Transcription factor 7-like 1 (HMG box transcription| factor 3) (TCF-3) Length = 553 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 287 PLLNNSSDSGIGDASTPAPRHI 222 PLL++ S +G+ DA +P+P H+ Sbjct: 132 PLLDSPSTAGLKDARSPSPAHL 153
>T7L1A_XENLA (P70062) Transcription factor 7-like 1-A (HMG box transcription| factor 3-A) (TCF-3-A) (xTcf-3) Length = 554 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 287 PLLNNSSDSGIGDASTPAPRHI 222 PLL++ S +G+ DA +P+P H+ Sbjct: 132 PLLDSPSTAGLKDARSPSPAHL 153
>T7L1B_XENLA (Q90ZB6) Transcription factor 7-like 1-B (HMG box transcription| factor 3-B) (TCF-3-B) (xTcf-3) Length = 551 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 287 PLLNNSSDSGIGDASTPAPRHI 222 PLL++ S +G+ DA +P+P H+ Sbjct: 132 PLLDSPSTAGLKDARSPSPAHL 153
>KAR3_YEAST (P17119) Kinesin-like protein KAR3 (Nuclear fusion protein)| Length = 729 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 329 KKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNK 189 + Q +STP P+ L N + +TP P+H + P+ D+++ Sbjct: 12 RSTQHLSTPSPKNDILAMNGHKRR--NTTTPPPKHTLLKPQRTDIHR 56
>GNAI2_CHICK (P50147) Guanine nucleotide-binding protein G(i), alpha-2 subunit| (Adenylate cyclase-inhibiting G alpha protein) Length = 354 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 155 ADYHPSQRDEMRKRI*SGGLISCTLTF 75 ADY P+Q+D +R R+ + G++ TF Sbjct: 165 ADYIPTQQDVLRTRVKTTGIVETHFTF 191
>CTND1_XENLA (Q8AXM9) Catenin delta-1 (p120 catenin) (p120(ctn)) (Xp120(ctn))| Length = 859 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = -2 Query: 266 DSGIGDASTPAPRHIFVMPELIDLNKLTQDPSKRKQVADYHPSQRDEMRKRI*S-GGLIS 90 D G+ D PRH+ P L++ ++ S S+R E R+++ GL+ Sbjct: 437 DGGMQDRVEGKPRHVEWEPALVNTTGCLRNIS----------SERSEARRKMRECEGLVD 486 Query: 89 CTLTFHTSRLSDKIDDDYLSHNLIC 15 + S +S + D L N++C Sbjct: 487 SVVHILRSEVSHGLVDSKLLENVVC 511
>ARGB_SULSO (Q980X0) Acetylglutamate/acetylaminoadipate kinase (EC 2.7.2.8) (EC| 2.7.2.-) (NAG kinase) (AGK) (N-acetyl-L-glutamate/N-acetyl-L-aminoadipate 5-phosphotransferase) Length = 264 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 196 KSISSGITKICLGAGVDASPIPLSLEL 276 +S+ +G+ K+ +G+GV PI +LEL Sbjct: 230 ESVENGVNKVIIGSGVKDRPIINALEL 256
>YGO9_YEAST (P53116) Hypothetical protein YGL149W precursor| Length = 101 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 251 LLFHYHLNCLVVAGPWAVVLTFLDFFYQVLLSYLSSFFCLNHEHTNW 391 LL+ L L+ G V L L FF LL + FFC EH ++ Sbjct: 6 LLYVLSLALLIWTGS-VVTLLLLLFFCLFLLFFSLHFFCFTREHVHY 51
>SFR12_MOUSE (Q8BZX4) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) Length = 494 Score = 27.3 bits (59), Expect = 9.0 Identities = 23/76 (30%), Positives = 36/76 (47%) Frame = -2 Query: 305 PLPRGLPLLNNSSDSGIGDASTPAPRHIFVMPELIDLNKLTQDPSKRKQVADYHPSQRDE 126 P+P PL SS G+ +S A + P + L ++ Q P + + PS+ DE Sbjct: 12 PIPTSSPLTAVSS-LGVSLSSLGAIPAAALDPNITTLGEIPQPPL----MGNVDPSKIDE 66 Query: 125 MRKRI*SGGLISCTLT 78 +R+ + G L S T T Sbjct: 67 IRRTVYVGNLNSQTTT 82
>ZDHC8_PANTR (Q2THX0) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 765 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = -2 Query: 371 LNRKKKKDSLGVLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAP 231 L R K K SL LD+K ++ PLP + SS D TP P Sbjct: 294 LGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSS-----DLQTPRP 335
>ZDHC8_HUMAN (Q9ULC8) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) (Zinc finger protein 378) Length = 765 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = -2 Query: 371 LNRKKKKDSLGVLDKKNQEMSTPLPRGLPLLNNSSDSGIGDASTPAP 231 L R K K SL LD+K ++ PLP + SS D TP P Sbjct: 294 LGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSS-----DLQTPRP 335
>LIP2_MORS1 (P24484) Lipase 2 (EC 3.1.1.3) (Triacylglycerol lipase)| Length = 433 Score = 27.3 bits (59), Expect = 9.0 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +2 Query: 29 DSNNHHQFCHSIC 67 D + HH+FCH++C Sbjct: 173 DIDTHHEFCHTVC 185
>GNAI2_CAVPO (P38402) Guanine nucleotide-binding protein G(i), alpha-2 subunit| (Adenylate cyclase-inhibiting G alpha protein) Length = 354 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -2 Query: 206 LIDLNKLTQDPSKRKQVADYHPSQRDEMRKRI*SGGLISCTLTF 75 L DL+++ Q +DY P+Q+D +R R+ + G++ TF Sbjct: 156 LNDLDRIAQ--------SDYIPTQQDVLRTRVKTTGIVETHFTF 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,071,008 Number of Sequences: 219361 Number of extensions: 1150760 Number of successful extensions: 2838 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 2755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2838 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
