| Clone Name | basd21m10 |
|---|---|
| Clone Library Name | barley_pub |
>INDY2_DROME (Q9VDQ0) Protein I'm not dead yet 2| Length = 562 Score = 26.6 bits (57), Expect(2) = 0.93 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 189 ILRYAHVLIVKQSYFTCHGLLPILFG 112 + +YAH+ K YF C G++P + G Sbjct: 505 VTQYAHI---KTKYFACCGIVPTIIG 527 Score = 24.3 bits (51), Expect(2) = 0.93 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 70 PHAAVFPSWAKRIRNSLR 17 P + FP WAK I+N + Sbjct: 544 PESKSFPDWAKEIKNQTK 561
>FUR2_DROME (P30432) Furin-like protease 2 precursor (EC 3.4.21.75) (Furin-2)| Length = 1679 Score = 30.8 bits (68), Expect = 2.4 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 508 RGPSLQFRC*ARRLQPLCY-RPPPTSS*NHVGLPWSCSPLC 389 RGP+ C RL C R PP S N VG+ W C C Sbjct: 979 RGPTQCVACSHYRLDNTCVSRCPPRSFPNQVGICWPCHDTC 1019
>YQJI_SHIFL (P64589) Hypothetical protein yqjI| Length = 207 Score = 29.6 bits (65), Expect = 5.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 177 HTEGCC*SWCPPRHVGCC 230 H EGCC PRH GCC Sbjct: 4 HHEGCCKHEGQPRHEGCC 21
>YQJI_ECOLI (P64588) Hypothetical protein yqjI| Length = 207 Score = 29.6 bits (65), Expect = 5.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 177 HTEGCC*SWCPPRHVGCC 230 H EGCC PRH GCC Sbjct: 4 HHEGCCKHEGQPRHEGCC 21
>PHZG_PSEFL (Q51793) Phenazine biosynthesis protein phzG| Length = 222 Score = 28.9 bits (63), Expect = 9.2 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 154 ELLHMPWVAAHLVW--AIEQV*YANSRSTIPHAAVFPSWAKR 35 ELLH PW + L W +Q+ +P+A +W KR Sbjct: 98 ELLHNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKR 139
>UQCR1_EUGGR (P43264) Ubiquinol-cytochrome-c reductase complex core protein I,| mitochondrial precursor (EC 1.10.2.2) Length = 494 Score = 28.9 bits (63), Expect = 9.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = +2 Query: 47 RRKNRGVWNCTSRVGVLDLFN-------RPNKMGSNPWH 142 R K ++C +R V+D ++ RPNK G NP H Sbjct: 292 RDKGEAAYSCFARAIVMDFYDPKVGQFFRPNKAGHNPIH 330
>SKP2_HUMAN (Q13309) S-phase kinase-associated protein 2 (F-box protein Skp2)| (Cyclin A/CDK2-associated protein p45) (p45skp2) (F-box/LRR-repeat protein 1) Length = 424 Score = 28.9 bits (63), Expect = 9.2 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = +1 Query: 112 PKQDGQQPMACEVTLFHYEDMGIPKDVAKVGVRHGMWGAVKKLQS-GFRAYQLMRKSEHI 288 P+ QP+A + F + M + V +V HG+ KLQ+ +L + Sbjct: 166 PRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT 225 Query: 289 LSHSAIMARVTTKTCIAGSDGSLDQWPSS 375 L+ ++ + R+ C S+ +L SS Sbjct: 226 LAKNSNLVRLNLSGCSGFSEFALQTLLSS 254 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,258,693 Number of Sequences: 219361 Number of extensions: 2040348 Number of successful extensions: 5663 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5661 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)