ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd21k22 |
|---|---|
| Clone Library Name | barley_pub |
>ASNS_SANAU (O24338) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 524 Score = 110 bits (274), Expect = 1e-24 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSKEG KRWYNPPWFSEVIPSVP+DPLALRKAFE AV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKEGSFKRWYNPPWFSEVIPSVPFDPLALRKAFEDAVIKRLMTDVPFGVLLSGG 234
>ASNS2_LOTJA (P49093) Asparagine synthetase [glutamine-hydrolyzing] 2 (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase 2) Length = 585 Score = 103 bits (258), Expect = 1e-22 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSKE +RWYNPPWFSE IPS PYDPLALR+AFEKA+ KRLMTDVPFGVLLSGG Sbjct: 179 YSSKEKEFRRWYNPPWFSEAIPSAPYDPLALRQAFEKAIIKRLMTDVPFGVLLSGG 234
>ASNS2_PEA (P19252) Asparagine synthetase, root [glutamine-hydrolyzing] (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase) Length = 582 Score = 102 bits (254), Expect = 3e-22 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK+ G +RWYNP W+SE IPS PYDPLALR AFEKAV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKDSGFRRWYNPSWYSEAIPSAPYDPLALRHAFEKAVVKRLMTDVPFGVLLSGG 234
>ASNS_ORYSA (Q43011) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 590 Score = 102 bits (253), Expect = 4e-22 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK GG +RWYNPPWFSE IPS PY+PL LR++FEKA+ KRLMTDVPFGVLLSGG Sbjct: 179 YSSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGG 234
>ASNS_TRIVS (O24661) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 585 Score = 100 bits (250), Expect = 8e-22 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK G +RWYNPPWFSE IPS PYDPL LR AFE+AV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKTEGFRRWYNPPWFSEAIPSTPYDPLVLRGAFEQAVIKRLMTDVPFGVLLSGG 234
>ASNS_ARATH (P49078) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 583 Score = 100 bits (250), Expect = 8e-22 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK GG K+WYNPPWF+E +PS PY+PLA+R+AFE AV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKLGGFKQWYNPPWFNESVPSTPYEPLAIRRAFENAVIKRLMTDVPFGVLLSGG 234
>ASNS_MAIZE (P49094) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 585 Score = 98.6 bits (244), Expect = 4e-21 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK GG +RWYNPPWFSE +PS PY+ L LR+ FEKAV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKTGGLRRWYNPPWFSETVPSTPYNALFLREMFEKAVIKRLMTDVPFGVLLSGG 234
>ASNS1_LOTJA (P49092) Asparagine synthetase [glutamine-hydrolyzing] 1 (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase 1) Length = 585 Score = 98.2 bits (243), Expect = 5e-21 Identities = 45/56 (80%), Positives = 48/56 (85%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSS+E +RWYNP WFSE IPS PYDPLA+R AFEKAV KRLMTDVPFGVLLSGG Sbjct: 179 YSSRERAFRRWYNPTWFSESIPSAPYDPLAVRHAFEKAVIKRLMTDVPFGVLLSGG 234
>ASNS1_PEA (P19251) Asparagine synthetase, nodule [glutamine-hydrolyzing] (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase) Length = 585 Score = 97.8 bits (242), Expect = 7e-21 Identities = 46/57 (80%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSE-VIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSKE +RWYNPPWF+E +IPS PYDPL LR AFEKAV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKEREFRRWYNPPWFNEAIIPSTPYDPLVLRNAFEKAVIKRLMTDVPFGVLLSGG 235
>ASNS_ASPOF (P31752) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (AS) Length = 589 Score = 97.4 bits (241), Expect = 9e-21 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSS+ G +RWYNP W++E IPS PYDPL LRKAFE AV KRLMTDVPFGVLLSGG Sbjct: 179 YSSRSGSFRRWYNPQWYNETIPSAPYDPLVLRKAFEDAVIKRLMTDVPFGVLLSGG 234
>ASNS_BRAOL (P49091) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 585 Score = 96.3 bits (238), Expect = 2e-20 Identities = 44/57 (77%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = +3 Query: 3 YSSKEGGX-KRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 YSSK GG K+WYNPPWF+E +PS PY+PLA+R AFE AV KRLMTDVPFGVLLSGG Sbjct: 179 YSSKSGGGFKQWYNPPWFNESVPSTPYEPLAIRSAFEDAVIKRLMTDVPFGVLLSGG 235
>ASNS1_YEAST (P49089) Asparagine synthetase [glutamine-hydrolyzing] 1 (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase 1) Length = 571 Score = 62.8 bits (151), Expect = 2e-10 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEV-IPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 Y SK R++ P W E IPS P D +A+R + EKAV KRLM +VP+GVLLSGG Sbjct: 180 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGG 236
>ASNS2_YEAST (P49090) Asparagine synthetase [glutamine-hydrolyzing] 2 (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase 2) Length = 571 Score = 59.3 bits (142), Expect = 3e-09 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSEV-IPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 Y S+ R++ P W E IPS P D A+R + EKAV KRLM +VP+GVLLSGG Sbjct: 180 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGG 236
>ASNS_SCHPO (P78753) Probable asparagine synthetase [glutamine-hydrolyzing] (EC| 6.3.5.4) (Glutamine-dependent asparagine synthetase) Length = 556 Score = 54.3 bits (129), Expect = 9e-08 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = +3 Query: 3 YSSKEGGXKRWYNPPWFSE-VIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 Y S+ R++ P W+ E IPS P D LR+ E +V KRLM +VP+GVLLSGG Sbjct: 182 YDSETKQTVRYFKPSWWDENKIPSNPVDYKLLRETLEASVRKRLMAEVPYGVLLSGG 238
>ASNB_ECOLI (P22106) Asparagine synthetase B [glutamine-hydrolyzing] (EC| 6.3.5.4) Length = 553 Score = 45.8 bits (107), Expect = 3e-05 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +3 Query: 9 SKEGGXKRWYNPPWFS-EVIPSVPYDPLALRKAFEKAVTKRLMTDVPFGVLLSGG 170 S++G + +Y+ WF + + D LR+A E +V LM+DVP+GVLLSGG Sbjct: 182 SQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGG 236
>ASNS_CRIGR (P19891) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 33.1 bits (74), Expect = 0.21 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F+ AV KRLMTD G LLSGG Sbjct: 234 LRILFDSAVRKRLMTDRRIGCLLSGG 259
>ASNS_MOUSE (Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F+ A+ KRLMTD G LLSGG Sbjct: 234 LRILFDNAIKKRLMTDRRIGCLLSGG 259
>ASNS_PONPY (Q5R6W9) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 32.3 bits (72), Expect = 0.36 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F AV KRLMTD G LLSGG Sbjct: 234 LRILFNNAVKKRLMTDRRIGCLLSGG 259
>ASNS_HUMAN (P08243) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) (Cell cycle control protein TS11) Length = 560 Score = 32.3 bits (72), Expect = 0.36 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F AV KRLMTD G LLSGG Sbjct: 234 LRILFNNAVKKRLMTDRRIGCLLSGG 259
>ASNS_RAT (P49088) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 32.0 bits (71), Expect = 0.47 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F A+ KRLMTD G LLSGG Sbjct: 234 LRILFNNAIKKRLMTDRRIGCLLSGG 259
>ASNO_BACSU (O05272) Asparagine synthetase [glutamine-hydrolyzing] 3 (EC| 6.3.5.4) Length = 614 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 +R F+ AVT++L++DVP LSGG Sbjct: 242 VRSLFQDAVTRQLVSDVPVCTFLSGG 267
>ASNS_MESAU (P17714) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 LR F+ AV KRLMTD LLSGG Sbjct: 234 LRILFDNAVRKRLMTDRRIVCLLSGG 259
>ASNS_CHICK (Q5ZJU3) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 93 LRKAFEKAVTKRLMTDVPFGVLLSGG 170 +R FE AV KRLM G LLSGG Sbjct: 234 IRVLFENAVRKRLMAHRRIGCLLSGG 259
>YVNF_AZOCH (P24423) Hypothetical protein in vnfD 5'region| Length = 516 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 27 KRWYNPPWFSEVIPSVPYDPLALRKAFEKAVTKRLMTD 140 KR + P WF P+ D L R+AF A+ + + TD Sbjct: 272 KREFRPYWFETGTPTFLVDLLTERRAFTPALEQVMATD 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,447,991 Number of Sequences: 219361 Number of extensions: 411338 Number of successful extensions: 1200 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
