| Clone Name | basd21c11 |
|---|---|
| Clone Library Name | barley_pub |
>ZN142_HUMAN (P52746) Zinc finger protein 142 (HA4654)| Length = 1687 Score = 29.3 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 342 DGDENAGRPDLACPYC 389 DGD +AG+P L CP+C Sbjct: 1414 DGDGDAGQPPLHCPFC 1429
>DBP4_NEUCR (Q7RZ35) ATP-dependent RNA helicase dbp-4 (EC 3.6.1.-)| Length = 823 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 161 RAGSGEERRVREPALYSTYPSIYLRRHGLGALDLAPGRRQAV 286 R GSG+ P L Y + + GLGAL ++P R AV Sbjct: 102 RTGSGKTLAFLVPVLEKLYRARWTEYDGLGALIISPTRELAV 143
>COAT_PAVL3 (P36310) Coat protein VP2| Length = 587 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 229 IDRWVGRI*GRLSHAPLLSRPRAR 158 I+RW+ G +++ PLLSRP AR Sbjct: 561 IERWLPTATGNITNVPLLSRPVAR 584
>DBP4_ASPFU (Q4WM60) ATP-dependent RNA helicase dbp4 (EC 3.6.1.-)| Length = 787 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 161 RAGSGEERRVREPALYSTYPSIYLRRHGLGALDLAPGRRQAV 286 + GSG+ P L + Y + GLGAL L+P R A+ Sbjct: 92 KTGSGKTLAFLVPVLENLYRKQWAEHDGLGALILSPTRELAI 133
>MK04_MOUSE (Q6P5G0) Mitogen-activated protein kinase 4 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 4) (ERK-4) Length = 583 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 220 IYLSTPAWTRSTGS---RAWPPPSGSTQRSSATPIG 318 ++L W +ST S RA PPP R SA+P G Sbjct: 485 LFLEIAQWVKSTQSGSERASPPPDAPEPRLSASPPG 520
>COBD_SALTY (P97084) Threonine-phosphate decarboxylase (EC 4.1.1.81)| (L-threonine-O-3-phosphate decarboxylase) Length = 364 Score = 28.5 bits (62), Expect = 9.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 463 GXAWGSKGCSSSRWAIREATSW 398 G A GC RW++REA W Sbjct: 112 GRALAQSGCEIRRWSLREADGW 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.129 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,472,098 Number of Sequences: 219361 Number of extensions: 584846 Number of successful extensions: 2343 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2343 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)