| Clone Name | basd21a16 |
|---|---|
| Clone Library Name | barley_pub |
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 60.8 bits (146), Expect(2) = 2e-13 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 258 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 344 MMSDYKVDMINDGM EFFVHFHGP DS Y Sbjct: 16 MMSDYKVDMINDGMHEFFVHFHGPKDSIY 44 Score = 33.1 bits (74), Expect(2) = 2e-13 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 113 MSSPSKRREMDLMKLSAAPTK 175 MSSPSKRREMDLMKL + K Sbjct: 1 MSSPSKRREMDLMKLMMSDYK 21
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 54.7 bits (130), Expect(2) = 1e-11 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 258 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 344 MMSDYKV+MINDGMQEFFV F GP DS Y Sbjct: 16 MMSDYKVEMINDGMQEFFVEFSGPKDSIY 44 Score = 33.1 bits (74), Expect(2) = 1e-11 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 113 MSSPSKRREMDLMKLSAAPTK 175 MSSPSKRREMDLMKL + K Sbjct: 1 MSSPSKRREMDLMKLMMSDYK 21
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 52.0 bits (123), Expect(2) = 1e-10 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +3 Query: 258 MMSDYKVDMINDGMQEFFVHFHGPNDSTY 344 MMSDYKV+ INDGMQEF+V F+GP DS Y Sbjct: 16 MMSDYKVETINDGMQEFYVEFNGPKDSLY 44 Score = 32.3 bits (72), Expect(2) = 1e-10 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 113 MSSPSKRREMDLMKLSAAPTK 175 MSSPSKRREMD+MKL + K Sbjct: 1 MSSPSKRREMDMMKLMMSDYK 21
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 48.9 bits (115), Expect(2) = 2e-09 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +3 Query: 258 MMSDYKVDMINDGMQEFFVHFHGPNDSTYPSASLSLSNPVP 380 MMSDYKVD +ND +Q F+V FHGP DS Y + +P Sbjct: 16 MMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELP 56 Score = 31.2 bits (69), Expect(2) = 2e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 113 MSSPSKRREMDLMKLSAAPTK 175 M+SPSKRREMD+MKL + K Sbjct: 1 MASPSKRREMDMMKLMMSDYK 21
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +3 Query: 258 MMSDYKVDMINDGMQEFFVHFHGPNDSTYPSASLSLSNPVP 380 +MSD++VD+IND MQEF V F GP D+ Y + L +P Sbjct: 16 LMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELP 56
>RIMM_ANASP (Q8YTB1) Probable 16S rRNA-processing protein rimM| Length = 246 Score = 28.1 bits (61), Expect = 8.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 57 GRKEGSKKQASRGRRRREPCLPQASGGRWIS*SCQQPLPNP 179 GR +G KKQ +GR+ R+ G + S Q P+PNP Sbjct: 19 GRGQGEKKQGKQGRQGRQ----GRQGEKSPVPSPQSPIPNP 55
>G6PI_GEOSL (Q74DK5) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 529 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 385 GAGTGLEREREAEGYVLSFGPWKW 314 GAG+ L+R EA G++ F W W Sbjct: 212 GAGSELDRTAEAGGWLCRFPMWDW 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,481,148 Number of Sequences: 219361 Number of extensions: 532304 Number of successful extensions: 1640 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1640 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)