| Clone Name | basd20f15 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 89.7 bits (221), Expect = 2e-18 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +2 Query: 2 LGSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 LGSVSNGGRIRCMQVWPIEGIKKFETL YLPPL E LLKQVDYLI Sbjct: 36 LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEGLLKQVDYLI 81
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 89.0 bits (219), Expect = 3e-18 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +2 Query: 2 LGSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 L SVSNGGRIRCMQVWPIEGIKKFETL YLPPL EALLKQVDYLI Sbjct: 36 LSSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLI 81
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 89.0 bits (219), Expect = 3e-18 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +2 Query: 2 LGSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 LGSVSNGGRIRCMQVWPIEGIKKFETL YLPPL EAL KQVDYLI Sbjct: 35 LGSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALSKQVDYLI 80
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 87.4 bits (215), Expect = 1e-17 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = +2 Query: 8 SVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SVSNGGRIRCMQVWPIEGIKKFETL YLPPL EALLKQVDYLI Sbjct: 37 SVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLI 80
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +2 Query: 5 GSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 G+VSNGGRIRCMQVWPIEGIKKFETL YLPPL E LLKQ++YL+ Sbjct: 37 GNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLL 81
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 78.6 bits (192), Expect = 5e-15 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 LGSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 LG+VSNGGRIRCMQVWP G KKFETL YLPPL + LLKQVDYL+ Sbjct: 36 LGNVSNGGRIRCMQVWPAYGNKKFETLSYLPPLSTDDLLKQVDYLL 81
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 77.8 bits (190), Expect = 8e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +2 Query: 5 GSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 G+VSNGGRI+ MQVWPIEGIKKFETL YLPPL E LLKQ++YL+ Sbjct: 37 GNVSNGGRIKFMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLL 81
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = +2 Query: 2 LGSVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 L VSNGGRIRCMQVWP G KKFETL YLPPL E LLKQVDYL+ Sbjct: 35 LAKVSNGGRIRCMQVWPAYGNKKFETLSYLPPLTQEQLLKQVDYLL 80
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 74.7 bits (182), Expect = 7e-14 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 17 NGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYL 136 +GGRIRCMQVWPIEGIKKFETL YLPPL E LLKQ++YL Sbjct: 39 HGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYL 78
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 72.0 bits (175), Expect = 4e-13 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWPIEG+KKFETL YLP + EAL+KQ++YL+ Sbjct: 51 SNGGRVQCMKVWPIEGVKKFETLSYLPTMKDEALVKQIEYLL 92
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 71.6 bits (174), Expect = 6e-13 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 91
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 71.6 bits (174), Expect = 6e-13 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 91
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 71.6 bits (174), Expect = 6e-13 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 50 SNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 91
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWPI G+KKFETL YLP L E+LLKQ++YLI Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLI 93
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWPI G+KKFETL YLP L E+LLKQ++YLI Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLI 93
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWPI G+KKFETL YLP L E+LLKQ++YLI Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLI 93
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWPI G+KKFETL YLP L E+LLKQ++YLI Sbjct: 52 SNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLI 93
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G+KKFETL YLPPL E+L K+VDYL+ Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLL 94
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G+KKFETL YLPPL E+L K+VDYL+ Sbjct: 53 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLL 94
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGG++ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 50 SNGGKVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 91
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G+KKFETL YLPPL E L K+VDYL+ Sbjct: 52 SNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLL 93
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 17 NGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 NGGR+ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 51 NGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 91
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 S+GGR+ CMQVWP EG+KKFETL YLPPL E L K+VDYL+ Sbjct: 46 SSGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLL 87
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G+KKFETL YLPPL E+LLK+V YL+ Sbjct: 51 SNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLLKEVQYLL 92
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 68.9 bits (167), Expect = 4e-12 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G+KK+ETL YLPPL EAL K++DYLI Sbjct: 50 SNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLI 91
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G++KFETL YLPPL E+L KQ++YLI Sbjct: 52 SNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLI 93
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL + LLK+V+YL+ Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLL 91
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL + LLK+V+YL+ Sbjct: 50 SNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLL 91
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL E+L+K+V YL+ Sbjct: 48 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLL 89
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL E+L+K+V YL+ Sbjct: 51 SNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLL 92
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 67.0 bits (162), Expect = 1e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGG+++CMQVWP G KKFETL YLPPL E+LLK+V YL+ Sbjct: 54 SNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLLKEVQYLL 95
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP G KKFETL YLPPL E L K+V+YLI Sbjct: 50 SNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLI 91
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 66.6 bits (161), Expect = 2e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNG R+RCMQVWP EG KKFETL YLPPL E L ++VDYLI Sbjct: 49 SNGLRVRCMQVWPPEGKKKFETLSYLPPLTREQLGQEVDYLI 90
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 +NGGR++CMQVWP G KKFETL YLPPL E+L+K+V YL+ Sbjct: 50 TNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLMKEVQYLL 91
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 65.9 bits (159), Expect = 3e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNG R+ CMQVWP G KKFETL YLPPL E LLK+V+YL+ Sbjct: 48 SNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLLKEVEYLL 89
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 65.1 bits (157), Expect = 5e-11 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP + +K++ETL YLPPL + L +QVDYL+ Sbjct: 50 SNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLL 91
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLL 91
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLL 91
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLL 91
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLL 92
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLLKEVEYLL 92
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LLK+V+YL+ Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLL 92
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 64.7 bits (156), Expect = 7e-11 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G+KK+ETL YLPPL L K+VDYL+ Sbjct: 48 SNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLAKEVDYLL 89
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 64.3 bits (155), Expect = 9e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 +NGGR+ CMQVWP +KKFETL YLP L E+LLK+++YL+ Sbjct: 49 TNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLL 90
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL LL QV YL+ Sbjct: 50 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLL 91
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL LL QV YL+ Sbjct: 53 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLL 94
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 64.3 bits (155), Expect = 9e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNG R++CMQVWP G KKFETL YLPPL + LLK+V+YL+ Sbjct: 6 SNGERVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLL 47
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLPPL LL QV YL+ Sbjct: 52 SNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLLAQVQYLL 93
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 63.9 bits (154), Expect = 1e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGG+++CM+VWP G+KKFETL YLPPL E L +V+YL+ Sbjct: 52 SNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLL 93
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KK+ETL YLP L E LLK+++YL+ Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLL 91
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KK+ETL YLP L E LLK+++YL+ Sbjct: 50 SNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLLKEIEYLL 91
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 8 SVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 + SNGGR+RCMQVWP G KFETL YLP L E L+K+V+YL+ Sbjct: 42 TTSNGGRVRCMQVWPPFGNPKFETLSYLPTLTEEQLVKEVEYLL 85
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 63.2 bits (152), Expect = 2e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM VWP G+KKFETL YLPPL E+LLK+V YL+ Sbjct: 51 SNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLLKEVQYLL 91
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 63.2 bits (152), Expect = 2e-10 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP G KKFETL YLP L L K+VDYLI Sbjct: 48 SNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLI 89
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G K +ETL YLPPL E L K+V+YL+ Sbjct: 52 SNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLL 93
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 62.8 bits (151), Expect = 3e-10 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LL +++YL+ Sbjct: 50 SNGGRVRCMQVWPPINMKKYETLSYLPDLSSEQLLSEIEYLL 91
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+RCMQVWP +KK+ETL YLP L E LL +++YL+ Sbjct: 51 SNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLL 92
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLP L L K+V+YL+ Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLL 89
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLP L L K+V+YL+ Sbjct: 48 SNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLAKEVEYLL 89
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 61.6 bits (148), Expect = 6e-10 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLP L L K+VDYL+ Sbjct: 52 SNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLL 93
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLP L L K+V+YL+ Sbjct: 48 SNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLAKEVEYLL 89
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 8 SVSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 + SNG R+RCMQVWP KKFETL YLP L E L+K+V+YL+ Sbjct: 58 TTSNGSRVRCMQVWPPYANKKFETLSYLPRLTPEQLVKEVEYLL 101
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP KK+ETL YLP L E LL++V+YL+ Sbjct: 51 SNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREVEYLL 92
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 60.5 bits (145), Expect = 1e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +2 Query: 11 VSNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 VSNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 47 VSNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLL 89
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP G KKFETL YLP L L K+V+YL+ Sbjct: 48 SNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLL 89
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 60.1 bits (144), Expect = 2e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP +KK+ETL YLP L E LL +++YL+ Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLL 91
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 60.1 bits (144), Expect = 2e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP +KK+ETL YLP L E LL +++YL+ Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLL 91
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 60.1 bits (144), Expect = 2e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CMQVWP +KK+ETL YLP L E LL +++YL+ Sbjct: 50 SNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLL 91
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G KK+ETL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPVGKKKYETLSYLPELTEAQLAKEVDYLL 84
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP KK+ETL YLP L E LL +V+YL+ Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLL 91
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP KK+ETL YLP L E LL +V+YL+ Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLL 91
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLL 89
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLL 89
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLL 89
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLL 89
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 59.3 bits (142), Expect = 3e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G KK+ETL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPLGKKKYETLSYLPDLTEVQLAKEVDYLL 84
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CMQVWP KK+ETL YLP L E LL +++YL+ Sbjct: 50 SNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEIEYLL 91
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 59.3 bits (142), Expect = 3e-09 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G KK+ETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVQCMKVWPPLGKKKYETLSYLPNLTEAQLAKEVDYLL 89
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 58.9 bits (141), Expect = 4e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM+VWP G KKFETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELGKEVDYLL 89
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 58.5 bits (140), Expect = 5e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G K++ETL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLL 84
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 58.2 bits (139), Expect = 6e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G K++ETL YLP L L K+VDYL+ Sbjct: 48 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEAQLAKEVDYLL 89
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 58.2 bits (139), Expect = 6e-09 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR+ CM VWP KK+ETL YLP L E LLK+++YL+ Sbjct: 50 SNGGRVECMLVWPPINKKKYETLSYLPDLSDEQLLKEIEYLL 91
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 57.8 bits (138), Expect = 8e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G K++ETL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLL 84
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 57.8 bits (138), Expect = 8e-09 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G K++ETL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLL 84
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 57.4 bits (137), Expect = 1e-08 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SN G+++CM+VWP G++KFETL YLP + E L K+ DYL+ Sbjct: 52 SNAGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLSKECDYLL 93
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 +NG R+ CMQVW KFETL YLPPL +AL KQ+DY+I Sbjct: 51 TNGSRVSCMQVWEPYNNLKFETLSYLPPLSQDALAKQIDYVI 92
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 14 SNGGRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 SNGGR++CM+VWP G KK+ TL YLP L L K+VDYL+ Sbjct: 43 SNGGRVQCMKVWPPLGKKKYXTLSYLPNLTEAQLAKEVDYLL 84
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 MQVWP G+KKFETL YLPPL E LL +V+YL+ Sbjct: 1 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLL 34
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 42.7 bits (99), Expect = 3e-04 Identities = 22/47 (46%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 5 GSVSNGGRIRC--MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 G SN +C M VW K FET YLPPL E + KQVDY++ Sbjct: 31 GFASNAAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 77
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 42.4 bits (98), Expect = 4e-04 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 11 VSNG--GRIRCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 +SNG + R M VW K FET YLPPL + + KQVDY++ Sbjct: 25 LSNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYIL 69
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET YLPPL E + KQVDY++ Sbjct: 42 RDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 77
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET YLPPL E + KQVDY++ Sbjct: 43 REMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 78
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET YLPPL E + KQVDY++ Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 76
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET YLPPL E + KQVDY++ Sbjct: 41 REMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYIL 76
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET +LPPL E + KQVDY++ Sbjct: 42 RDMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 77
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET +LPPL E + KQVDY++ Sbjct: 41 RGMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 39.3 bits (90), Expect = 0.003 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET +LPPL E + KQVDY++ Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 39.3 bits (90), Expect = 0.003 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET +LPPL E + KQVDY++ Sbjct: 41 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 76
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 39.3 bits (90), Expect = 0.003 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +2 Query: 32 RCMQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 R M VW K FET +LPPL E + KQVDY++ Sbjct: 32 REMMVWQPFNNKMFETFSFLPPLTDEQISKQVDYIL 67
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M VW K FET YLPPL E + QVDY++ Sbjct: 46 MMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIV 79
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M VW K FET YLPPL E + QVDY++ Sbjct: 46 MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIV 79
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 1141 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 1174 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 997 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 1030 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 854 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 887 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 709 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 742 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 566 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 599 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 422 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 455 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 279 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 312 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M+VW KKFET YLPPL + KQVD +I Sbjct: 135 MKVWNPVNNKKFETFSYLPPLSDAQIAKQVDMII 168
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 36.6 bits (83), Expect = 0.020 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 41 QVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 +VW K++ET YLPPL + + +QVDY+I Sbjct: 30 KVWQPVNNKQYETFSYLPPLTNQKIGRQVDYII 62
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 35.8 bits (81), Expect = 0.034 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 86 YLPPLXXEALLKQVDYLI 139 YLPPL EALLKQVDYLI Sbjct: 2 YLPPLSTEALLKQVDYLI 19
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 33.9 bits (76), Expect = 0.13 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +++ETL YLPPL + + KQV++L+ Sbjct: 8 RRYETLSYLPPLTDQQIAKQVEFLL 32
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 33.5 bits (75), Expect = 0.17 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +++ETL YLPPL + + +Q++Y++ Sbjct: 8 RRYETLSYLPPLSDQQIARQIEYMV 32
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 33.5 bits (75), Expect = 0.17 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 K++ETL YLPPL + + +QV Y++ Sbjct: 8 KRYETLSYLPPLSDQQIARQVQYMM 32
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 33.1 bits (74), Expect = 0.22 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 MQ P E +++ETL YLPPL + KQV Y++ Sbjct: 1 MQTLPKE--RRYETLSYLPPLTDVQIEKQVQYIL 32
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 33.1 bits (74), Expect = 0.22 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +KFET YLP L E + KQV+Y++ Sbjct: 17 RKFETFSYLPELGVEKIRKQVEYIV 41
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 32.7 bits (73), Expect = 0.28 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 K+FET YLP + E + KQ++Y++ Sbjct: 24 KRFETFSYLPQMSAEEIRKQIEYIV 48
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 31.6 bits (70), Expect = 0.63 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 ++FET YLPPL + Q++Y+I Sbjct: 9 RRFETFSYLPPLSDRQIAAQIEYMI 33
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 31.6 bits (70), Expect = 0.63 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 62 IKKFETLXYLPPLXXEALLKQVDYLI 139 I ++ET YLPPL E +L+Q+ Y++ Sbjct: 13 IGRYETFSYLPPLNREEILEQILYIL 38
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 31.2 bits (69), Expect = 0.83 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +KFET YLP + + + KQV+Y++ Sbjct: 16 RKFETFSYLPRMDADRIRKQVEYIV 40
>RBS_THIDA (Q56260) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 30.8 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +KFET YLP + + KQV+YL+ Sbjct: 17 RKFETFSYLPAMNAADIRKQVEYLV 41
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 30.8 bits (68), Expect = 1.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 65 KKFETLXYLPPLXXEALLKQVDYLI 139 +KFET YLPPL + + +Q+ Y + Sbjct: 7 RKFETFSYLPPLNDQQIARQLQYAL 31
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 68 KFETLXYLPPLXXEALLKQVDYLI 139 KFETL YLP L + + +QV Y++ Sbjct: 18 KFETLSYLPALTADEIRQQVAYIV 41
>RBS_THINE (P45686) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 68 KFETLXYLPPLXXEALLKQVDYLI 139 K+ET YLPP+ E + Q+ Y I Sbjct: 12 KYETFSYLPPMNAERIRAQIKYAI 35
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 86 YLPPLXXEALLKQVDYLI 139 YLPPL E + KQVDY++ Sbjct: 3 YLPPLTDEQISKQVDYIL 20
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 38 MQVWPIEGIKKFETLXYLPPLXXEALLKQVDYLI 139 M V +KK+ET YLP + E + +Q+ + I Sbjct: 1 MAVQAYRSLKKYETFSYLPQMTPEQVRRQIAHAI 34
>RBS1_THIFE (P28896) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 110 Score = 28.1 bits (61), Expect = 7.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 68 KFETLXYLPPLXXEALLKQVDYLI 139 K+ET YLP + E + +Q+ YLI Sbjct: 12 KYETFSYLPAMGPEKMRRQIAYLI 35
>KNAP3_MALDO (O04136) Homeobox protein knotted-1-like 3 (KNAP3)| Length = 427 Score = 27.7 bits (60), Expect = 9.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 7 QRQQRWKDQVHAGVAHRGHQEVRDPXXLA 93 Q +W Q H + HR H +V D +A Sbjct: 97 QASNQWLSQSHRPILHRNHSDVNDDVTVA 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,962,772 Number of Sequences: 219361 Number of extensions: 227051 Number of successful extensions: 765 Number of sequences better than 10.0: 121 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)