ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd20f12 |
|---|---|
| Clone Library Name | barley_pub |
>ATG8_PHYIN (Q8H715) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 116 Score = 60.8 bits (146), Expect(2) = 4e-14 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +1 Query: 34 SSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 SSFK EHP E+RQAEA RIR KY DRIPVI EKA +SD Sbjct: 2 SSFKKEHPFEKRQAEAQRIRSKYPDRIPVICEKADRSD 39 Score = 34.7 bits (78), Expect(2) = 4e-14 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVPADLTVGQF Sbjct: 42 DIDKKKYLVPADLTVGQF 59
>ATG8_NEUCR (Q8WZY7) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier atg-8) Length = 121 Score = 59.7 bits (143), Expect(2) = 2e-13 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR+KYSDRIPVI EK KSD Sbjct: 2 RSKFKDEHPFEKRKAEAERIRQKYSDRIPVICEKVEKSD 40 Score = 33.5 bits (75), Expect(2) = 2e-13 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVPADLTVGQF Sbjct: 42 ATIDKKKYLVPADLTVGQF 60
>ATG8_CRYNE (Q5KN30) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 126 Score = 60.5 bits (145), Expect(2) = 3e-13 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 25 MAKSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 M +S FK EHP ++R+AEA RIR+KY DRIPVI EKA KSD Sbjct: 1 MVRSKFKDEHPFDKRKAEAERIRQKYQDRIPVICEKAEKSD 41 Score = 32.3 bits (72), Expect(2) = 3e-13 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 158 IDKNXFLVPADLTVGQF 208 IDK +LVPADLTVGQF Sbjct: 45 IDKKKYLVPADLTVGQF 61
>ATG8_MAGGR (Q51MW4) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 123 Score = 58.5 bits (140), Expect(2) = 4e-13 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR+KY+DRIPVI EK KSD Sbjct: 2 RSKFKDEHPFEKRKAEAERIRQKYTDRIPVICEKVEKSD 40 Score = 33.5 bits (75), Expect(2) = 4e-13 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVPADLTVGQF Sbjct: 42 ATIDKKKYLVPADLTVGQF 60
>ATG8_PODAN (Q8J282) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) (Induced during the incompatibility reaction protein 7) Length = 121 Score = 58.5 bits (140), Expect(2) = 4e-13 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR+KY+DRIPVI EK KSD Sbjct: 2 RSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSD 40 Score = 33.5 bits (75), Expect(2) = 4e-13 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVPADLTVGQF Sbjct: 42 ATIDKKKYLVPADLTVGQF 60
>ATG8_ASPFU (Q4WJ27) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier atg8) Length = 118 Score = 58.5 bits (140), Expect(2) = 4e-13 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR+KY+DRIPVI EK KSD Sbjct: 2 RSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSD 40 Score = 33.5 bits (75), Expect(2) = 4e-13 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVPADLTVGQF Sbjct: 42 ATIDKKKYLVPADLTVGQF 60
>ATG8_YARLI (Q6C794) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 137 Score = 58.5 bits (140), Expect(2) = 1e-12 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +1 Query: 22 SMAKSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 S +S FK EHP E+R+AEA RIR+KY DR+PVI EK KSD Sbjct: 12 SRVRSKFKDEHPFEKRRAEAERIRKKYDDRVPVICEKVEKSD 53 Score = 32.3 bits (72), Expect(2) = 1e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 158 IDKNXFLVPADLTVGQF 208 IDK +LVPADLTVGQF Sbjct: 57 IDKKKYLVPADLTVGQF 73
>ATG8_EMENI (Q5B2U9) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier atg8) Length = 118 Score = 57.4 bits (137), Expect(2) = 1e-12 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR KY+DRIPVI EK KSD Sbjct: 2 RSKFKDEHPFEKRKAEAERIRAKYADRIPVICEKVEKSD 40 Score = 33.5 bits (75), Expect(2) = 1e-12 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVPADLTVGQF Sbjct: 42 ATIDKKKYLVPADLTVGQF 60
>ATG8_LACBI (P87068) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 184 Score = 57.4 bits (137), Expect(2) = 5e-12 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR+KY DRIPVI EKA ++D Sbjct: 2 RSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKADRTD 40 Score = 31.2 bits (69), Expect(2) = 5e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 158 IDKNXFLVPADLTVGQF 208 IDK +LVP+DLTVGQF Sbjct: 44 IDKKKYLVPSDLTVGQF 60
>ATG8_CANGA (Q6FXR8) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 118 Score = 55.1 bits (131), Expect(2) = 8e-12 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 KSSFK E+P E+R+AE+ RI EK+ +RIPVI EKA KSD Sbjct: 2 KSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSD 40 Score = 32.7 bits (73), Expect(2) = 8e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 ++DK +LVPADLTVGQF Sbjct: 43 EVDKRKYLVPADLTVGQF 60
>ATG8_PICAN (Q5QFG1) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 125 Score = 54.3 bits (129), Expect(2) = 2e-11 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP ERR+AEA+RIR K+ DRIPVI EK +SD Sbjct: 2 RSQFKDEHPFERRKAEASRIRGKFLDRIPVICEKVEESD 40 Score = 32.0 bits (71), Expect(2) = 2e-11 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 +IDK +LVP+DLTVGQF Sbjct: 43 EIDKRKYLVPSDLTVGQF 60
>ATG8_USTMA (Q4P2U6) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier atg8) Length = 118 Score = 55.1 bits (131), Expect(2) = 2e-11 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S+FK EH E+R+AEA RIR+KY DRIPVI EKA ++D Sbjct: 2 RSAFKNEHSFEKRKAEAERIRQKYPDRIPVICEKADRTD 40 Score = 31.2 bits (69), Expect(2) = 2e-11 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 158 IDKNXFLVPADLTVGQF 208 IDK +LVP+DLTVGQF Sbjct: 44 IDKKKYLVPSDLTVGQF 60
>ATG8_PICPA (Q8NJJ4) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) (Pexophagy zeocin-resistant mutant protein 2) Length = 125 Score = 54.7 bits (130), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RIR K++DRIPVI EK KSD Sbjct: 2 RSQFKDEHPFEKRKAEAMRIRYKFADRIPVICEKVEKSD 40 Score = 31.2 bits (69), Expect(2) = 3e-11 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 ++DK +LVP DLTVGQF Sbjct: 43 EVDKRKYLVPCDLTVGQF 60
>ATG8_YEAST (P38182) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) (Cytoplasm to vacuole targeting protein 5) Length = 117 Score = 51.6 bits (122), Expect(2) = 6e-11 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 KS+FK E+P E+R+AE+ RI +++ +RIPVI EKA KSD Sbjct: 2 KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSD 40 Score = 33.1 bits (74), Expect(2) = 6e-11 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 +IDK +LVPADLTVGQF Sbjct: 43 EIDKRKYLVPADLTVGQF 60
>GBRAP_RAT (P60517) Gamma-aminobutyric acid receptor-associated protein| (GABA(A) receptor-associated protein) Length = 117 Score = 51.6 bits (122), Expect(2) = 8e-11 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSDXG 153 K +K EHP E+R++E +IR+KY DR+PVIVEKA K+ G Sbjct: 2 KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIG 42 Score = 32.7 bits (73), Expect(2) = 8e-11 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKKKYLVPSDLTVGQF 60
>GBRAP_RABIT (Q8MK68) Gamma-aminobutyric acid receptor-associated protein| (GABA(A) receptor-associated protein) Length = 117 Score = 51.6 bits (122), Expect(2) = 8e-11 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSDXG 153 K +K EHP E+R++E +IR+KY DR+PVIVEKA K+ G Sbjct: 2 KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIG 42 Score = 32.7 bits (73), Expect(2) = 8e-11 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKKKYLVPSDLTVGQF 60
>GBRAP_MOUSE (Q9DCD6) Gamma-aminobutyric acid receptor-associated protein| (GABA(A) receptor-associated protein) Length = 117 Score = 51.6 bits (122), Expect(2) = 8e-11 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSDXG 153 K +K EHP E+R++E +IR+KY DR+PVIVEKA K+ G Sbjct: 2 KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIG 42 Score = 32.7 bits (73), Expect(2) = 8e-11 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKKKYLVPSDLTVGQF 60
>GBRAP_HUMAN (O95166) Gamma-aminobutyric acid receptor-associated protein| (GABA(A) receptor-associated protein) (MM46) Length = 117 Score = 51.6 bits (122), Expect(2) = 8e-11 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSDXG 153 K +K EHP E+R++E +IR+KY DR+PVIVEKA K+ G Sbjct: 2 KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIG 42 Score = 32.7 bits (73), Expect(2) = 8e-11 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKKKYLVPSDLTVGQF 60
>ATG8_KLULA (Q6CMF8) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 124 Score = 50.8 bits (120), Expect(2) = 1e-10 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 KS+FK E P E+R+AE+ RI +K+ +RIPVI E+ GKSD Sbjct: 2 KSAFKSEFPFEKRKAESERIVQKFHNRIPVICERGGKSD 40 Score = 33.1 bits (74), Expect(2) = 1e-10 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVP DLTVGQF Sbjct: 43 DIDKRKYLVPGDLTVGQF 60
>ATG8_CANAL (P0C075) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 135 Score = 51.6 bits (122), Expect(2) = 2e-10 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+RQAEA RI +++ DR+PVI EK SD Sbjct: 2 RSQFKDEHPFEKRQAEAARIAQRFKDRVPVICEKVENSD 40 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 +IDK +LVP DLTVGQF Sbjct: 43 EIDKRKYLVPVDLTVGQF 60
>ATG8_DEBHA (Q6BT31) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 136 Score = 52.4 bits (124), Expect(2) = 3e-10 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK EHP E+R+AEA RI ++++DR+PVI EKA SD Sbjct: 2 RSQFKDEHPFEKRKAEATRITQRFNDRLPVICEKAENSD 40 Score = 30.0 bits (66), Expect(2) = 3e-10 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 +IDK +LVP DL+VGQF Sbjct: 43 EIDKRKYLVPGDLSVGQF 60
>ATG8_SCHPO (O94272) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier atg8) Length = 121 Score = 48.9 bits (115), Expect(2) = 9e-10 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 +S FK + E+R+ E+ RIREKY DRIPVI EK KSD Sbjct: 2 RSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSD 40 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 152 ADIDKNXFLVPADLTVGQF 208 A IDK +LVP+DLTVGQF Sbjct: 42 AAIDKKKYLVPSDLTVGQF 60
>LGG1_CAEEL (Q09490) Protein lgg-1| Length = 123 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K ++K E+ E+R+AE ++IR KY DRIPVIVEKA KS Sbjct: 2 KWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKS 39 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKKKYLVPSDLTVGQF 60
>GBRL1_PONPY (Q5RF21) Gamma-aminobutyric acid receptor-associated protein-like 1| (GABA(A) receptor-associated protein-like 1) Length = 117 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K +K +HP E R+ E +IR+KY DR+PVIVEKA K+ Sbjct: 2 KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKA 39 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKRKYLVPSDLTVGQF 60
>GBRL1_MOUSE (Q8R3R8) Gamma-aminobutyric acid receptor-associated protein-like 1| (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) Length = 117 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K +K +HP E R+ E +IR+KY DR+PVIVEKA K+ Sbjct: 2 KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKA 39 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKRKYLVPSDLTVGQF 60
>GBRL1_HUMAN (Q9H0R8) Gamma-aminobutyric acid receptor-associated protein-like 1| (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1) (Early estrogen-regulated protein) Length = 117 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K +K +HP E R+ E +IR+KY DR+PVIVEKA K+ Sbjct: 2 KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKA 39 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKRKYLVPSDLTVGQF 60
>GBRL1_CAVPO (P60518) Gamma-aminobutyric acid receptor-associated protein-like 1| (GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) Length = 117 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K +K +HP E R+ E +IR+KY DR+PVIVEKA K+ Sbjct: 2 KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKA 39 Score = 32.7 bits (73), Expect(2) = 1e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 43 DLDKRKYLVPSDLTVGQF 60
>ATG8_ASHGO (Q755X2) Autophagy-related protein 8 precursor (Autophagy-related| ubiquitin-like modifier ATG8) Length = 120 Score = 47.4 bits (111), Expect(2) = 3e-09 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +1 Query: 34 SSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKSD 147 SSFK E+P E+R+AE+ RI ++ +R+PVI E+A KSD Sbjct: 2 SSFKSEYPFEKRKAESERICSQFENRVPVICERAEKSD 39 Score = 31.6 bits (70), Expect(2) = 3e-09 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 ++D+ +LVPADLTVGQF Sbjct: 42 EVDRRKYLVPADLTVGQF 59
>GBRL1_BOVIN (Q8HYB6) Gamma-aminobutyric acid receptor-associated protein-like 1| (GABA(A) receptor-associated protein-like 1) (Fragment) Length = 111 Score = 44.7 bits (104), Expect(2) = 9e-09 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = +1 Query: 49 EHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 +HP E R+ E +IR+KY DR+PVIVEKA K+ Sbjct: 1 DHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKA 32 Score = 32.7 bits (73), Expect(2) = 9e-09 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+DK +LVP+DLTVGQF Sbjct: 36 DLDKRKYLVPSDLTVGQF 53
>GBRL3_HUMAN (Q9BY60) Gamma-aminobutyric acid receptor-associated protein-like 3| (GABA(A) receptor-associated protein-like 3) Length = 117 Score = 45.1 bits (105), Expect(2) = 9e-08 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K +K HP E R+ E +IR+KY DR+P+IVEKA K+ Sbjct: 2 KFQYKEVHPFEYRKKEGEKIRKKYPDRVPLIVEKAPKA 39 Score = 28.9 bits (63), Expect(2) = 9e-08 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 D+D+ +LVP+DLT GQF Sbjct: 43 DLDRRKYLVPSDLTDGQF 60
>GBRL2_RAT (P60522) Gamma-aminobutyric acid receptor-associated protein-like 2| (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) Length = 117 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K FK +H LE R E+ +IR KY DR+PVIVEK S Sbjct: 2 KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGS 39 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVP+D+TV QF Sbjct: 43 DIDKRKYLVPSDITVAQF 60
>GBRL2_MOUSE (P60521) Gamma-aminobutyric acid receptor-associated protein-like 2| (GABA(A) receptor-associated protein-like 2) Length = 117 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K FK +H LE R E+ +IR KY DR+PVIVEK S Sbjct: 2 KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGS 39 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVP+D+TV QF Sbjct: 43 DIDKRKYLVPSDITVAQF 60
>GBRL2_HUMAN (P60520) Gamma-aminobutyric acid receptor-associated protein-like 2| (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (MAP1 light chain 3-related protein) Length = 117 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K FK +H LE R E+ +IR KY DR+PVIVEK S Sbjct: 2 KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGS 39 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVP+D+TV QF Sbjct: 43 DIDKRKYLVPSDITVAQF 60
>GBRL2_BOVIN (P60519) Gamma-aminobutyric acid receptor-associated protein-like 2| (GABA(A) receptor-associated protein-like 2) (Ganglioside expression factor 2) (GEF-2) (General protein transport factor p16) (Golgi-associated ATPase enhancer of 16 kDa) (GA Length = 117 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 31 KSSFKLEHPLERRQAEANRIREKYSDRIPVIVEKAGKS 144 K FK +H LE R E+ +IR KY DR+PVIVEK S Sbjct: 2 KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGS 39 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 155 DIDKNXFLVPADLTVGQF 208 DIDK +LVP+D+TV QF Sbjct: 43 DIDKRKYLVPSDITVAQF 60
>MLP3C_HUMAN (Q9BXW4) Microtubule-associated proteins 1A/1B light chain 3C| precursor (Microtubule-associated protein 1 light chain 3 gamma) (MAP1A/MAP1B LC3 C) (MAP1A/1B light chain 3 C) (MAP1 light chain 3-like protein 3) (Autophagy-related protein LC3 C Length = 147 Score = 29.3 bits (64), Expect(2) = 0.046 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 40 FKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 FK L RQ E IR K+ ++IPV+VE+ Sbjct: 13 FKQRKSLAIRQEEVAGIRAKFPNKIPVVVER 43 Score = 25.0 bits (53), Expect(2) = 0.046 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 158 IDKNXFLVPADLTVGQF 208 +DK FLVP +LT+ QF Sbjct: 53 LDKTKFLVPQELTMTQF 69
>LGG2_CAEEL (Q23536) Protein lgg-2| Length = 130 Score = 31.2 bits (69), Expect = 0.77 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 37 SFKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 SFK P RQ + IR + +++PVI+E+ Sbjct: 16 SFKERRPFHERQKDVEEIRSQQPNKVPVIIER 47
>MLP3B_MOUSE (Q9CQV6) Microtubule-associated proteins 1A/1B light chain 3B| precursor (Microtubule-associated protein 1 light chain 3 beta) (MAP1A/MAP1B LC3 B) (MAP1A/1B light chain 3 B) (MAP1 light chain 3-like protein 2) (Autophagy-related protein LC3 B) Length = 124 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 28 AKSSFKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 ++ +FK E+R + IRE++ +IPVI+E+ Sbjct: 2 SEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIER 36
>MLP3B_HUMAN (Q9GZQ8) Microtubule-associated proteins 1A/1B light chain 3B| precursor (Microtubule-associated protein 1 light chain 3 beta) (MAP1A/MAP1B LC3 B) (MAP1A/1B light chain 3 B) (MAP1 light chain 3-like protein 2) (Autophagy-related protein LC3 B) Length = 124 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 28 AKSSFKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 ++ +FK E+R + IRE++ +IPVI+E+ Sbjct: 2 SEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIER 36
>MLP3B_RAT (Q62625) Microtubule-associated proteins 1A/1B light chain 3B| precursor (Microtubule-associated protein 1 light chain 3 beta) (MAP1A/MAP1B LC3 B) (MAP1A/1B light chain 3 B) (MAP1 light chain 3-like protein 2) (Autophagy-related protein LC3 B) ( Length = 141 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 28 AKSSFKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 ++ +FK E+R + IRE++ +IPVI+E+ Sbjct: 2 SEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIER 36
>MLP3B_BOVIN (O41515) Microtubule-associated proteins 1A/1B light chain 3B| (Microtubule-associated protein 1 light chain 3 beta) (MAP1A/MAP1B LC3 B) (MAP1A/1B light chain 3 B) (MAP1 light chain 3-like protein 2) (Autophagy-related protein LC3 B) (Autophag Length = 119 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 37 SFKLEHPLERRQAEANRIREKYSDRIPVIVEK 132 +FK E+R + IRE++ +IPVI+E+ Sbjct: 5 TFKQRRTFEQRVEDVRLIREQHPTKIPVIIER 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,481,296 Number of Sequences: 219361 Number of extensions: 186278 Number of successful extensions: 782 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
