| Clone Name | basd20c19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAB36_HUMAN (O95755) Ras-related protein Rab-36 | 30 | 3.6 | 2 | RPOC2_ANASP (P22705) DNA-directed RNA polymerase beta' chain (EC... | 30 | 6.1 |
|---|
>RAB36_HUMAN (O95755) Ras-related protein Rab-36| Length = 333 Score = 30.4 bits (67), Expect = 3.6 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 357 SWTLGRVGRSASRRAPTYSTLRPASRS 437 SW LGR S ++ PT ST+R A RS Sbjct: 7 SWMLGRAAASPTQTPPTTSTIRVARRS 33
>RPOC2_ANASP (P22705) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1355 Score = 29.6 bits (65), Expect = 6.1 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 9/80 (11%) Frame = -1 Query: 555 LLPRNTPMXTD-SRXTPKMNLKAMIPEGSRSCX--------CAGFTEARSAMPAEGSSRS 403 + PRNTP+ D ++ K + ++ +C C G++ A + M G + Sbjct: 262 IAPRNTPISDDLAKEIEKAGVAEVVVRSPLTCEAARSVCQHCYGWSLAHAKMVDLGEAVG 321 Query: 402 VLAVRRTGRPGPRSNYELFN 343 ++A + G PG + F+ Sbjct: 322 IIAAQSIGEPGTQLTMRTFH 341 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,649,667 Number of Sequences: 219361 Number of extensions: 1435482 Number of successful extensions: 3519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3519 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)