| Clone Name | basd20b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POF13_SCHPO (O94334) F-box protein pof13 | 32 | 1.7 | 2 | YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region | 31 | 2.9 | 3 | P3P_LACLC (P15292) PIII-type proteinase precursor (EC 3.4.21.96)... | 29 | 8.4 |
|---|
>POF13_SCHPO (O94334) F-box protein pof13| Length = 396 Score = 31.6 bits (70), Expect = 1.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 317 TLTPVIFGSYLVFRVCLDLVPLAXPAPKQCFTPRCPVNCC 198 TLT ++F+ LD +P P +C RCP+N C Sbjct: 223 TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNAC 262
>YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region| Length = 154 Score = 30.8 bits (68), Expect = 2.9 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 130 VVVRGEMPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGXASG 258 V+ +G +PL PR W++ + AQQLT ++ G+G +G Sbjct: 82 VLEKGGLPLNPRGEWYTKDTI-AQQLTMRAFMEELRGSGVDTG 123
>P3P_LACLC (P15292) PIII-type proteinase precursor (EC 3.4.21.96) (Lactocepin)| (Cell wall-associated serine proteinase) Length = 1902 Score = 29.3 bits (64), Expect = 8.4 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 271 QTLNTRYDPKITGVKVGQ*DDGX*ASSSRGKQPGSPAKAPK*PLSDKGGGGAK 429 Q+L T+ + K DG +S +G G+PA AP DKG G++ Sbjct: 1779 QSLKTKVAAAVEAAKTVGKGDGTTGTSDKGGGQGTPAPAPGDTGKDKGDEGSQ 1831 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,048,850 Number of Sequences: 219361 Number of extensions: 1525290 Number of successful extensions: 3315 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3314 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)