| Clone Name | basd19o18 |
|---|---|
| Clone Library Name | barley_pub |
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 32.7 bits (73), Expect = 0.25 Identities = 21/58 (36%), Positives = 25/58 (43%) Frame = +2 Query: 62 PLGILYLPTCVGFGYRYPFVEGRSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYF 235 P+G YL T F + RS FSW G GY SA + G + GSYF Sbjct: 172 PVGTCYLSTD-NFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYF 228
>DOK1_MOUSE (P97465) Docking protein 1 (Downstream of tyrosine kinase 1)| (p62(dok)) Length = 482 Score = 31.2 bits (69), Expect = 0.73 Identities = 27/82 (32%), Positives = 33/82 (40%), Gaps = 12/82 (14%) Frame = -3 Query: 228 EPRGLAIASPRGSY------------QALRR*SM*PMPYSQEKLERPSTKGYLYPKPTQV 85 EP GLA A PRG Y QA + +PY+ P+T Y P P Sbjct: 363 EPEGLAPAPPRGLYDLPQEPRDAWWCQARLKEEGYELPYN------PATDDYAVPPP--- 413 Query: 84 GR*RIPRGHPFSRSYGAILPSS 19 R P+ P + G ILP S Sbjct: 414 ---RSPKPAPAPKPQGLILPES 432
>NHR54_CAEEL (O45460) Nuclear hormone receptor family member nhr-54| Length = 422 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -1 Query: 191 HTRRYGAEVCNRCHTPRKSSNDLQQKGTCTRNRHRWVGREYLGGTPSPEVTGLFCR 24 H + +G E C C + + L +K CTR G+ +G + +V FCR Sbjct: 25 HGQHFGVETCRACAAFFRRTVVLNRKYKCTRKS----GKCKIGSDETKDVMCKFCR 76
>CYCG_RHOS4 (Q53143) Diheme cytochrome c-type| Length = 296 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -1 Query: 164 CNRCHTPRKSSNDLQQKGTCTRNRHRWVGREYLGGTPSPEVTG 36 C CHTPR G R++ RW L G P+PE G Sbjct: 202 CGECHTPR--------NGLGLRDKSRW-----LAGGPNPEGRG 231
>YBIC_ECOLI (P30178) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 172 LKYVTDAILPGKARTTFNKRVPVP 101 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>YBIC_ECO57 (P58409) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 172 LKYVTDAILPGKARTTFNKRVPVP 101 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,756,895 Number of Sequences: 219361 Number of extensions: 946454 Number of successful extensions: 2393 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2392 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)