| Clone Name | basd19i12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KIF1B_RAT (O88658) Kinesin-like protein KIF1B | 31 | 2.9 | 2 | KIF1B_MOUSE (Q60575) Kinesin-like protein KIF1B | 30 | 3.8 | 3 | KIF1B_HUMAN (O60333) Kinesin-like protein KIF1B (Klp) | 30 | 3.8 | 4 | TGB2_CVB (P37989) TGB2 protein (Triple gene block 2 protein) (TG... | 30 | 5.0 | 5 | INVSB_XENLA (Q71S21) Inversin-B | 30 | 6.5 |
|---|
>KIF1B_RAT (O88658) Kinesin-like protein KIF1B| Length = 1816 Score = 30.8 bits (68), Expect = 2.9 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -2 Query: 541 PRKPSSLVRHPWA*EK-QLLHCDSQEAMHQLVSHHMLSGKHPLADKSSLSPKLFS 380 PR S ++ H W EK +LLH + ++ H L+ L P + SLSP L S Sbjct: 1483 PRGDSLILEHQWELEKLELLH-EVEKTRHFLLLRERLGDSIPKSMSDSLSPSLSS 1536
>KIF1B_MOUSE (Q60575) Kinesin-like protein KIF1B| Length = 1816 Score = 30.4 bits (67), Expect = 3.8 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -2 Query: 541 PRKPSSLVRHPWA*EK-QLLHCDSQEAMHQLVSHHMLSGKHPLADKSSLSPKLFS 380 PR S ++ H W EK +LLH + ++ H L+ L P + SLSP L S Sbjct: 1483 PRGDSLILEHQWELEKLELLH-EVEKTRHFLLLRERLGDSVPKSLSDSLSPSLSS 1536
>KIF1B_HUMAN (O60333) Kinesin-like protein KIF1B (Klp)| Length = 1816 Score = 30.4 bits (67), Expect = 3.8 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -2 Query: 541 PRKPSSLVRHPWA*EK-QLLHCDSQEAMHQLVSHHMLSGKHPLADKSSLSPKLFS 380 PR S ++ H W EK +LLH + ++ H L+ L P + SLSP L S Sbjct: 1483 PRGDSLILEHQWELEKLELLH-EVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSS 1536
>TGB2_CVB (P37989) TGB2 protein (Triple gene block 2 protein) (TGBp2) (12 kDa| protein) (ORF 3 protein) Length = 106 Score = 30.0 bits (66), Expect = 5.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 310 SLTNQVWYLPIPLRKMVFLISCDEGESHIYGPIH 209 +L Q W+L I L +FL+SC G + G H Sbjct: 73 NLPVQPWFLVILLSAAIFLLSCRSGHRRVCGQCH 106
>INVSB_XENLA (Q71S21) Inversin-B| Length = 1002 Score = 29.6 bits (65), Expect = 6.5 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = +1 Query: 265 FFSKGWGGTKLDLL-----------ERMVKQLFPEAPCQSWPPTAVQPKWKTVWETKNSC 411 FFSK W ++L+ E+ KQLF ++ T +Q W+T W K+SC Sbjct: 932 FFSK-WQNIDIELIPVQARLQLVEREKARKQLFQR---KNHAATVIQKAWRTYWVRKSSC 987 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,445,409 Number of Sequences: 219361 Number of extensions: 2019723 Number of successful extensions: 5351 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5348 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)