| Clone Name | basd19h24 |
|---|---|
| Clone Library Name | barley_pub |
>NUOG_BUCAI (P57257) NADH-quinone oxidoreductase chain G (EC 1.6.99.5) (NADH| dehydrogenase I, chain G) (NDH-1, chain G) Length = 906 Score = 34.7 bits (78), Expect = 0.15 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = -3 Query: 500 FWDILPYYSELHTIYSKQYKIFIYRQTNHTQQQIKPFSDDVYSHNKKRSVANVHCFTKS- 324 +W+I+PYY QY I T + + SD + KK S+ +C K Sbjct: 812 YWNIIPYYHLFGNEELTQYSSIIQENT-PLEYALIGLSDAIKMGLKKDSIVEFNCLKKDY 870 Query: 323 -IPIRASGYKSLPVQLILAIGRRVF 252 +P++ S Y + Q+ L IGR+ F Sbjct: 871 CLPVQVSKYLT-EKQIGLPIGRKGF 894
>YP183_YEAST (Q08924) WD-repeat protein YPL183C| Length = 1013 Score = 32.0 bits (71), Expect = 1.0 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -3 Query: 440 IFIYRQTNHTQQQIKPFSDDVYSHNKKRSVANVHCFTKSIPIRASGYKSL 291 + +Y T + + P S D+ H +++N+ +P+ SG KSL Sbjct: 839 LVVYNITEYVPFSVDPISGDLVDHKLDATISNLPAPVAQLPVHQSGVKSL 888
>ZN689_RAT (Q99PJ7) Zinc finger protein 689 (Transcription factor HIT-39)| Length = 500 Score = 29.6 bits (65), Expect = 5.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 65 GRCVRASGAAKNARTTGRAERLGLGDAAGRAFP*PSFAAV 184 GRC R S + N RTT E+ + GR F PS A+ Sbjct: 239 GRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAI 278
>ZN689_MOUSE (Q8BKK5) Zinc finger protein 689| Length = 500 Score = 29.6 bits (65), Expect = 5.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 65 GRCVRASGAAKNARTTGRAERLGLGDAAGRAFP*PSFAAV 184 GRC R S + N RTT E+ + GR F PS A+ Sbjct: 239 GRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAI 278
>ZN689_HUMAN (Q96CS4) Zinc finger protein 689| Length = 500 Score = 29.6 bits (65), Expect = 5.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 65 GRCVRASGAAKNARTTGRAERLGLGDAAGRAFP*PSFAAV 184 GRC R S + N RTT E+ + GR F PS A+ Sbjct: 239 GRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAI 278
>RPOP_HALMA (Q5V1M2) DNA-directed RNA polymerase subunit P (EC 2.7.7.6)| Length = 44 Score = 29.3 bits (64), Expect = 6.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 121 CPTCGSRILRRTRSPDTSSLLIS 53 CP CG R+L + RSPD + ++ Sbjct: 22 CPYCGHRVLLKERSPDVKEINVN 44
>PTUCB_FUSMR (O06900) PTS system alpha-glucoside-specific EIICB component| [Includes: Alpha-glucoside permease IIC component (PTS system alpha-glucoside-specific EIIC component); Alpha-glucoside-specific phosphotransferase enzyme IIB component (EC 2.7.1.69 Length = 526 Score = 29.3 bits (64), Expect = 6.5 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +1 Query: 262 LPMARMSCTGKLLYPEALMGILFVKQCTLATDLFLLWLYTSSENGLI 402 +P A ++C L++P+ MGI ++ + + F +WLYT E LI Sbjct: 183 IPCAYITC---LVWPKIQMGISSLQALMVTSGTFGVWLYTFLERILI 226
>GLGB1_CLOPE (Q8XPA2) 1,4-alpha-glucan branching enzyme 1 (EC 2.4.1.18)| (Glycogen branching enzyme 1) (BE 1) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase 1) Length = 674 Score = 28.9 bits (63), Expect = 8.5 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 479 YSELHTIYSKQY--KIFIYRQTNHTQQQIKPFSDDVYSHNKK 360 Y+EL IY K + K+ NH+++ I P S D H KK Sbjct: 423 YNELDPIYRKYHHNKLTFPMMYNHSEKFILPISHDEVVHGKK 464
>SI1L1_MOUSE (Q8C0T5) Signal-induced proliferation-associated 1-like protein 1| Length = 1782 Score = 28.9 bits (63), Expect = 8.5 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = -3 Query: 311 ASGYKSLPVQLIL-----AIGRRVFNGHRSVRQHSLRGAQNTRRIPVP 183 +S Y SLP L L +G + +G S SL Q TRR P+P Sbjct: 1595 SSTYPSLPKSLPLRRPSYTLGMKSLHGEFSASDSSLTDIQETRRQPIP 1642
>GIP1_YEAST (P38229) GLC7-interacting protein 1| Length = 573 Score = 28.9 bits (63), Expect = 8.5 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 1/95 (1%) Frame = +3 Query: 84 LVRRRMREPQVGQRDWGSVMLPDAPSLDPHLQPWYRNAARVLSSAETV-LPNRAMPVKYS 260 L R+R RE GS++ D L +P N A S+ ++ P P+KY Sbjct: 15 LKRKRFREWLRPSTAHGSLLHSDTLDLRDFAKP---NPADTFSNLDSGHCPLVTTPIKYE 71 Query: 261 PTDGKDELYRQALIP*SPDGDTFCEAMYISHRSFF 365 DGK +R GDT E ++ S+R F+ Sbjct: 72 CPDGKSSFFR---------GDTKFETLF-SNRKFY 96
>NUDEL_DROME (P98159) Serine protease nudel precursor (EC 3.4.21.-)| Length = 2616 Score = 28.9 bits (63), Expect = 8.5 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 229 CLTERCPLNTRLPMARMSCTGK 294 C T RCPL T LP A M C G+ Sbjct: 2310 CSTHRCPLGTCLPQAAM-CNGR 2330
>TOP1_THEAC (Q9HM08) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 770 Score = 28.9 bits (63), Expect = 8.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = -1 Query: 178 CK*GSREGASGSITEPQSLCPTCG---SRILRRTRSPD 74 CK R +GSIT CP CG +I+R+ +SP+ Sbjct: 616 CKINFRIKRNGSITLSDQKCPVCGLPMIKIIRKGQSPE 653 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,012,297 Number of Sequences: 219361 Number of extensions: 1659200 Number of successful extensions: 5048 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5047 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)