| Clone Name | basd18n19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PIN4_ORYSA (Q6ZIB5) Probable auxin efflux carrier component 4 (O... | 30 | 8.1 | 2 | IRS2A_XENLA (Q9DF49) Insulin receptor substrate 2-A (IRS-2-A) (I... | 30 | 8.1 | 3 | IRS2B_XENLA (Q5RJW5) Insulin receptor substrate 2-B (IRS-2-B) | 30 | 8.1 |
|---|
>PIN4_ORYSA (Q6ZIB5) Probable auxin efflux carrier component 4 (OsPIN4)| Length = 370 Score = 29.6 bits (65), Expect = 8.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 225 WSLPFVVERSLQLKM*WQPLILI-FGLRMYWLVGRG 329 W+ VV+ ++ M W PL+L+ F LR W+VG G Sbjct: 134 WAQDLVVQIAVVQSMVWFPLLLMAFELRKAWVVGGG 169
>IRS2A_XENLA (Q9DF49) Insulin receptor substrate 2-A (IRS-2-A) (Insulin receptor| substrate-unique) (Insulin receptor substrate-undetermined designation) (xIRS-u) Length = 1074 Score = 29.6 bits (65), Expect = 8.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 356 DALTRPNGLRV---P*GKFYLADAGYGAKPGFLPPFRGVRYHLNEWGNNPPINEK 511 + LTRP+ V P +++ YG+ PG L FR + GN PPI E+ Sbjct: 436 ETLTRPSSSSVCGSPSDGGFISSDEYGSSPGDLRYFRVRSNTPDSLGNTPPIQEE 490
>IRS2B_XENLA (Q5RJW5) Insulin receptor substrate 2-B (IRS-2-B)| Length = 1077 Score = 29.6 bits (65), Expect = 8.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 356 DALTRPNGLRV---P*GKFYLADAGYGAKPGFLPPFRGVRYHLNEWGNNPPINEK 511 + LTRP+ V P +++ YG+ PG L FR + GN PPI E+ Sbjct: 439 ETLTRPSSSSVCGSPSDGGFISSDEYGSSPGDLRYFRVRSNTPDSLGNTPPIQEE 493 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,864,557 Number of Sequences: 219361 Number of extensions: 2221038 Number of successful extensions: 4570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4570 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)