| Clone Name | basd18j14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 27 | 9.8 |
|---|
>COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 549 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 178 NVMLLLCCIFCIT*FLNFVLFSVAALMISSTVVLKYHVDRNCVL 309 +++L LC +FC+ F ++ LF V+ + S + CV+ Sbjct: 465 SLILFLCALFCVFLFWDYCLFFVSLFVFSLYCFFYFSTWLPCVM 508 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,652,765 Number of Sequences: 219361 Number of extensions: 542180 Number of successful extensions: 1289 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1289 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)