| Clone Name | basd18j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUDC_CHICK (Q5ZIN1) Nuclear migration protein nudC (Nuclear dist... | 30 | 3.0 | 2 | YP01_HUMAN (Q7Z4Q2) Protein FLJ20718 | 30 | 5.1 |
|---|
>NUDC_CHICK (Q5ZIN1) Nuclear migration protein nudC (Nuclear distribution| protein C homolog) Length = 341 Score = 30.4 bits (67), Expect = 3.0 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = +1 Query: 301 DYEFTDTTGEVELRLDIGKLGIESSRDVFVDVDDTSLLIRAKSDGTLRTLMNVGTLFDRV 480 +Y +T T E++L + +DV VD+ L + K + G LF+ V Sbjct: 181 NYRWTQTLSELDLAIPFKVTFRLKGKDVVVDIQRRRLRVGLKGHPPVID----GELFNEV 236 Query: 481 KSSETIWFIDE 513 K E+ W I++ Sbjct: 237 KVEESSWLIED 247
>YP01_HUMAN (Q7Z4Q2) Protein FLJ20718| Length = 680 Score = 29.6 bits (65), Expect = 5.1 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 355 KLGIESSRDVFVDVDDTSLL-----IRAKSDGTLRTLMNVGTLFDRVKSSE 492 K GI SS +V V V+ S+L + AK DGTL TL N+G V + + Sbjct: 545 KAGIHSS-NVGVRVNVVSILGITGSVLAKEDGTLETLKNIGCFLLEVTTKD 594 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,975,487 Number of Sequences: 219361 Number of extensions: 702137 Number of successful extensions: 1560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)