| Clone Name | basd18i22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab po... | 28 | 7.1 | 2 | TAF5_MOUSE (Q8C092) Transcription initiation factor TFIID subuni... | 28 | 7.1 | 3 | MMRN2_HUMAN (Q9H8L6) Multimerin-2 precursor (EMILIN-3) (Elastin ... | 28 | 7.1 |
|---|
>R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; Unknown protein 1; 3C-like Length = 6684 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/54 (22%), Positives = 22/54 (40%) Frame = +1 Query: 262 CYSFFCYFSLFGSCCLLISSSMLVITANSTCYMVESREIYTVGI*CKHYLVCCK 423 CY + +FG C LI ++ + N+ Y V + + +Y + K Sbjct: 2682 CYGVLKFKKIFGDCTFLIVMIIVTLVVNNVSYFVTQNTFFMIIYAIVYYFITRK 2735
>TAF5_MOUSE (Q8C092) Transcription initiation factor TFIID subunit 5| (Transcription initiation factor TFIID 100 kDa subunit) (TAF(II)100) (TAFII-100) (TAFII100) Length = 801 Score = 28.5 bits (62), Expect = 7.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 3 PEEEEDAGLESCAHLLHALHPSVPGAPLPDP 95 P E + AG E+ + LL + SVPG+ P+P Sbjct: 134 PGELDGAGAEAASALLSRVTASVPGSAAPEP 164
>MMRN2_HUMAN (Q9H8L6) Multimerin-2 precursor (EMILIN-3) (Elastin microfibril| interface located protein 3) (Elastin microfibril interfacer 3) (EndoGlyx-1 p125/p140 subunit) Length = 949 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 128 NFPHSIVRDLPGIWKRSPGDRRMKSMKEMSTG 33 N H + LPG+WK PG+ M+ TG Sbjct: 186 NDVHRVADSLPGLWKALPGNLTAAVMEANQTG 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,114,008 Number of Sequences: 219361 Number of extensions: 663140 Number of successful extensions: 2611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2605 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)