| Clone Name | basd17d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPN_HAECO (Q10737) Aminopeptidase N (EC 3.4.11.2) (Microsomal a... | 31 | 2.5 | 2 | PER1_VOLCA (P81131) Perphorin-1 precursor (Perphorin I) | 30 | 3.3 |
|---|
>AMPN_HAECO (Q10737) Aminopeptidase N (EC 3.4.11.2) (Microsomal aminopeptidase)| (Membrane glycoprotein H11) Length = 971 Score = 30.8 bits (68), Expect = 2.5 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 2/99 (2%) Frame = +1 Query: 67 FSPXTNGRLSNDAWHHADADSVEYFNLADLWEQYYEWSAYGAGATVQLQGGDKVVQYY-- 240 +SP T + +DA+ A D++EY + +L Y E + + G +++Y+ Sbjct: 649 YSPRTRNAIISDAFAAAATDAIEYETVFELL-NYAEKETEYLPLEIAMSGISSILKYFGT 707 Query: 241 VPYLSGIQLYTNKVLNASRSFGEDYAMDFWSDDDDNEKM 357 P Q Y ++N + E ++DF +++ N+K+ Sbjct: 708 EPEAKPAQTY---MMNILKPMYEKSSIDFIANNYRNDKL 743
>PER1_VOLCA (P81131) Perphorin-1 precursor (Perphorin I)| Length = 512 Score = 30.4 bits (67), Expect = 3.3 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = -3 Query: 218 PPCSCTVAPAPYALHS*YCSHRSA------RLKYSTLSASAWCHASLDSRPLVLGENVRV 57 P C C +P+PY+L S+R+ R+ + SA+ +C D + + + N Sbjct: 29 PYCQCIKSPSPYSLEPVVKSNRTGQYCFTLRVTKPSPSATGYCATKADIKKIEINVNQVC 88 Query: 56 DRRGGAVEEAL 24 D G V L Sbjct: 89 DVFGNVVNATL 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,681,510 Number of Sequences: 219361 Number of extensions: 1358813 Number of successful extensions: 3987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3985 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)