| Clone Name | basd17c12 |
|---|---|
| Clone Library Name | barley_pub |
>FTSZ_MYCPU (Q50318) Cell division protein ftsZ| Length = 390 Score = 30.8 bits (68), Expect = 2.0 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 241 MATIARRLRACWIQIMSVPIRFSGWLSRLQKSKGLRLTRAIS 366 +A IAR L A I I++ P F G L +G++ RA+S Sbjct: 115 IAKIARELGALTISIVTTPFEFEGNLRNKNAQEGIKNLRAVS 156
>FABG_AQUAE (O67610) 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100)| (3-ketoacyl-acyl carrier protein reductase) Length = 248 Score = 30.0 bits (66), Expect = 3.5 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 19 GRPGAPPYSTGKAGMLGQLMSLAKEAPP 102 G G YST KAG++G SLAKE P Sbjct: 150 GNVGQVNYSTTKAGLIGFTKSLAKELAP 177
>GAG_HV1EL (P04592) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 29.6 bits (65), Expect = 4.5 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 168 RSGHPCRISAHCNCPRKV*LQPWWRLFRERHELAQHXGFTGRVWGSTWPAH 16 + GH I+ +C PRK + WR +E H+L G WP+H Sbjct: 397 KEGH---IAKNCRAPRK---KGCWRCGKEGHQLKDCTERQANFLGRIWPSH 441
>PIGO_HUMAN (Q8TEQ8) Phosphatidylinositol-glycan biosynthesis, class O protein| (PIG-O) Length = 1089 Score = 29.3 bits (64), Expect = 5.9 Identities = 27/94 (28%), Positives = 36/94 (38%), Gaps = 6/94 (6%) Frame = +2 Query: 11 VQWAGQVLPHTLPVKPXCWASSCLSRKRRHHGWSYTFR---GQLQC---ADILQGCPDRE 172 + W GQ+LP L P +S + RH+G +Y R G L C A + CP+ Sbjct: 588 LHWEGQLLPPKLLTMPRL-GTSATTNPPRHNG-AYALRLGIGLLLCTRLAGLFHRCPEET 645 Query: 173 KNHPEGDWTERRAPNGTGACSLPWRQLHGDCVLA 274 W A G W +G CV A Sbjct: 646 PVCHSSPWLSPLASMVGGRAKNLW---YGACVAA 676
>GAG_HV1OY (P20889) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 498 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -1 Query: 168 RSGHPCRISAHCNCPRKV*LQPWWRLFRERHELAQHXGFTGRVWGSTWPAH 16 + GH I+ +C PRK + W+ RE H++ G WP+H Sbjct: 395 KEGH---IAKNCRAPRK---KGCWKCGREGHQMKDCTERQANFLGKIWPSH 439
>NODG_RHIME (P06234) Nodulation protein G (Host-specificity of nodulation| protein C) Length = 245 Score = 29.3 bits (64), Expect = 5.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 16 VGRPGAPPYSTGKAGMLGQLMSLAKE 93 +G PG Y KAGM+G SLA+E Sbjct: 144 IGNPGQTNYCASKAGMIGFSKSLAQE 169
>GAG_HV1C4 (P05887) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -1 Query: 168 RSGHPCRISAHCNCPRKV*LQPWWRLFRERHELAQHXGFTGRVWGSTWPAH 16 + GH I+ +C PRK + W+ RE H++ G WP+H Sbjct: 396 KEGH---IARNCKAPRK---KGCWKCGREGHQMKDCTERQANFLGKIWPSH 440
>DNAK_THEFY (Q47TI0) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 613 Score = 29.3 bits (64), Expect = 5.9 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = +3 Query: 243 GDNCTEIACLLDPDHVGADQ-----VQWLVEQIAEEQGLEVDKGYFTDLSKDMM 389 GD E+ +H+G D V WLVE+ G+ DLSKD M Sbjct: 183 GDGVVEVKATHGDNHLGGDDWDQAVVDWLVERFKSSNGI--------DLSKDKM 228
>CYSZ_ERWCT (Q6D8S7) Protein cysZ homolog| Length = 275 Score = 28.9 bits (63), Expect = 7.7 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 359 ALVNLKPLL-FCNLLNQPLNLIGTDMIWIQQARNLRA 252 ALV+L L+ F NL+ P+ + G +W+ + RNL A Sbjct: 232 ALVSLFTLVPFLNLVIMPVAVCGATQLWVDRYRNLSA 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,585,609 Number of Sequences: 219361 Number of extensions: 1577720 Number of successful extensions: 5094 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5090 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)