| Clone Name | basd16d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XDH_CALVI (P08793) Xanthine dehydrogenase (EC 1.17.1.4) (XD) | 32 | 1.8 | 2 | HSS_RHOVI (O32323) Homospermidine synthase (EC 2.5.1.44) (HSS) | 30 | 5.3 | 3 | SC6A8_TORMA (Q91502) Creatine transporter | 29 | 9.0 | 4 | BAIG_EUBSP (P32369) Bile acid transporter | 29 | 9.0 |
|---|
>XDH_CALVI (P08793) Xanthine dehydrogenase (EC 1.17.1.4) (XD)| Length = 1353 Score = 31.6 bits (70), Expect = 1.8 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -2 Query: 239 TGHRRPFLHTWL*SFLREGRAAGAKLWRYTYL*LSVEVYLSIIHVAMF 96 TG R PFL + +F EGR G + Y S+++ S++ AMF Sbjct: 859 TGTRHPFLFKYKIAFTSEGRLTGCYIECYNNAGWSMDLSFSVLERAMF 906
>HSS_RHOVI (O32323) Homospermidine synthase (EC 2.5.1.44) (HSS)| Length = 477 Score = 30.0 bits (66), Expect = 5.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 46 ITNRQXQGVAFPKPFPTNIATWMIDKYTS 132 I R Q +FPKPF + TW ++ + S Sbjct: 208 IAERDTQRASFPKPFDVFVNTWSVEGFVS 236
>SC6A8_TORMA (Q91502) Creatine transporter| Length = 611 Score = 29.3 bits (64), Expect = 9.0 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -3 Query: 271 VCETHPGRCRRQDTDVPFFTPGSNPSLEREELLGPSCGGILIS-DSLWRYTYL 116 +C+ R Q DVP PGS + R+ SC G + ++WR+ YL Sbjct: 13 LCKEMRAPRRAQPPDVPAGEPGSRVTWSRQMDFIMSCVGFAVGLGNVWRFPYL 65
>BAIG_EUBSP (P32369) Bile acid transporter| Length = 477 Score = 29.3 bits (64), Expect = 9.0 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -3 Query: 178 LLGPSCGGILISDSLWRYTYLSSMWLCL 95 ++GP+CGG++++ + WR MW+C+ Sbjct: 149 VVGPTCGGLIMNAAGWRV----MMWVCV 172 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,371,566 Number of Sequences: 219361 Number of extensions: 2112054 Number of successful extensions: 4441 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4439 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)