| Clone Name | basd16d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y550_BUCBP (Q89A13) Hypothetical UPF0070 protein bbp_550 | 31 | 2.6 | 2 | JHD1_ASPFU (Q4WHB7) JmjC domain-containing histone demethylation... | 31 | 2.6 | 3 | PURK_SYNP7 (Q54975) Phosphoribosylaminoimidazole carboxylase ATP... | 29 | 9.7 |
|---|
>Y550_BUCBP (Q89A13) Hypothetical UPF0070 protein bbp_550| Length = 193 Score = 30.8 bits (68), Expect = 2.6 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 507 FDTCSVVQEVLPMYFFSNSYADRSLRLTRMSSMCTYWTRSIEIKAGRSM 361 F TC ++ ++ +YFFS +Y D+ + M T+ T S E+ +++ Sbjct: 18 FLTCMLLIVIVIVYFFSKNYLDKPKNSYVHTKMMTFLTNSNELNISKNL 66
>JHD1_ASPFU (Q4WHB7) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 1418 Score = 30.8 bits (68), Expect = 2.6 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +1 Query: 349 GEMRHGAPSLDLNASGPVCTHTAHPGESQASISIAVGEEIHGKD--FLDDGTSVEFMQDA 522 G+M H +DL AS T H G +Q ++ AVG+ + F D +E Sbjct: 1188 GDMSHTQRPVDLEASSYFGTAHDHNGIAQTKLTSAVGQTSYASPPAFQSDTVVMEVAGQG 1247 Query: 523 LKQPTA 540 + +PTA Sbjct: 1248 VSKPTA 1253
>PURK_SYNP7 (Q54975) Phosphoribosylaminoimidazole carboxylase ATPase subunit| (EC 4.1.1.21) (AIR carboxylase) (AIRC) Length = 395 Score = 28.9 bits (63), Expect = 9.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 456 NSYADRSLRLTRMSSMCTYWTRSIEIKAGRSMTHLS 349 + YA+ +L + C YW E K GR + H++ Sbjct: 325 SGYAELRQQLAALPGACLYWYGKTESKPGRKLGHIT 360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,659,936 Number of Sequences: 219361 Number of extensions: 1648759 Number of successful extensions: 3961 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3961 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)