| Clone Name | basd16b17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CH... | 31 | 2.9 | 2 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 30 | 3.8 | 3 | TIM44_YEAST (Q01852) Import inner membrane translocase subunit T... | 29 | 8.5 |
|---|
>CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase)| (Choline acetylase) (ChAT) Length = 748 Score = 30.8 bits (68), Expect = 2.9 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 372 ASL*GGTLPYRCILTSHSFGRSLSPVHLQRKGARSVSYYALFKGWLLLGKPPGCLCTPTS 193 ASL G L Y+ +L SHS + L + YY LF + L G L S Sbjct: 236 ASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNS 295 Query: 192 FI 187 I Sbjct: 296 SI 297
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 3.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 443 IQCPENPRFPPQGSSTEGESGPK 511 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89
>TIM44_YEAST (Q01852) Import inner membrane translocase subunit TIM44,| mitochondrial precursor (Mitochondrial protein import protein 1) (Inner membrane import site protein 45) (ISP45) (Membrane import machinery protein MIM44) Length = 431 Score = 29.3 bits (64), Expect = 8.5 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 34 SGTKSRQTLNTRYDPKITGVKVGQXXXXXXASSSRGKQPGSP 159 SGT SR TL RY + TG+ V + + ++G P SP Sbjct: 10 SGTSSR-TLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSP 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,698,085 Number of Sequences: 219361 Number of extensions: 1661604 Number of successful extensions: 4203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4202 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)