| Clone Name | basd16b15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN133_HUMAN (P52736) Zinc finger protein 133 | 30 | 4.3 | 2 | GLNA1_DAUCA (O22504) Glutamine synthetase, cytosolic isozyme (EC... | 30 | 7.3 | 3 | RL26_LITLI (Q95WA0) 60S ribosomal protein L26 | 30 | 7.3 | 4 | YGCF_SHIFL (P64556) Hypothetical protein ygcF | 29 | 9.6 | 5 | YGCF_ECOLI (P64554) Hypothetical protein ygcF | 29 | 9.6 | 6 | YGCF_ECO57 (P64555) Hypothetical protein ygcF | 29 | 9.6 |
|---|
>ZN133_HUMAN (P52736) Zinc finger protein 133| Length = 654 Score = 30.4 bits (67), Expect = 4.3 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Frame = +3 Query: 363 CMHQFSLPPTSLISGKHTHAGHSPWE--------GIKSMLGRFQ-WHGGEPPVL 497 C H FS T LIS + TH G P+ +KS L R Q H GE P++ Sbjct: 415 CGHSFSQNST-LISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIV 467
>GLNA1_DAUCA (O22504) Glutamine synthetase, cytosolic isozyme (EC 6.3.1.2)| (Glutamate--ammonia ligase) (GS1) Length = 352 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 60 LESLHAQHVAAYTEGKE 10 LE+ HAQH+AAY EG E Sbjct: 272 LETKHAQHIAAYGEGNE 288
>RL26_LITLI (Q95WA0) 60S ribosomal protein L26| Length = 144 Score = 29.6 bits (65), Expect = 7.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 314 KRFKAADHAPAHANKKVYASIFTSSNKSDFRETYSCRSLPLGRN 445 K K +AP+H +K I +S + R+ Y+CRS+P+ ++ Sbjct: 13 KNRKRHFNAPSHMRRK----IMSSPMSKELRQKYNCRSMPIRKD 52
>YGCF_SHIFL (P64556) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 544 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 431 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112
>YGCF_ECOLI (P64554) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 544 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 431 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112
>YGCF_ECO57 (P64555) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 9.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 544 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 431 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,148,735 Number of Sequences: 219361 Number of extensions: 1423784 Number of successful extensions: 3988 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3984 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)