| Clone Name | basd16b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AREG_HUMAN (P15514) Amphiregulin precursor (AR) (Colorectum cell... | 31 | 2.7 | 2 | NFAE_ECOLI (P46738) Chaperone protein nfaE precursor | 30 | 4.6 | 3 | MST2_DROHY (Q08696) Axoneme-associated protein mst101(2) | 30 | 6.0 | 4 | HD2C_ARATH (Q9LZR5) Histone deacetylase 2c (HD-tuins protein 3) | 30 | 6.0 | 5 | SNUT1_HUMAN (O43290) U4/U6.U5 tri-snRNP-associated protein 1 (U4... | 29 | 7.8 | 6 | CT129_HUMAN (Q9H4H8) Protein C20orf129 | 29 | 7.8 |
|---|
>AREG_HUMAN (P15514) Amphiregulin precursor (AR) (Colorectum cell-derived| growth factor) (CRDGF) Length = 252 Score = 30.8 bits (68), Expect = 2.7 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +3 Query: 96 NAQKSKMARERNLEKLKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAEA 266 N +S+ ++ K KGGK + N+K N C Q F C E K EH EA Sbjct: 113 NKTESENTSDKPKRKKKGGKNGKNRRNRKKKN-PCNAEFQNF-CIHGECKYIEHLEA 167
>NFAE_ECOLI (P46738) Chaperone protein nfaE precursor| Length = 247 Score = 30.0 bits (66), Expect = 4.6 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 11/79 (13%) Frame = +3 Query: 21 SPPNFRRTXKVSSRLAEESTAMGGGNAQKSKMARE---------RNLEKLKGGKGSQLEA 173 +PP FRR + SSR ST GG + +R+ + ++ GK + +A Sbjct: 98 TPPLFRRDGQQSSRRRSVST---GGEFPSDRESRQWICVKGIPPKEDDRWAEGKDGEKKA 154 Query: 174 NKKAMNIQCKI--CMQTFI 224 +K ++N+Q + C++ F+ Sbjct: 155 DKVSLNVQLSVSSCIKLFV 173
>MST2_DROHY (Q08696) Axoneme-associated protein mst101(2)| Length = 1391 Score = 29.6 bits (65), Expect = 6.0 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Frame = +3 Query: 99 AQKSKMARERNLEKLKGGKGSQ------LEANKKAMNIQCKICMQTFICTTSEAKCKEHA 260 A+K K A E+N K K GKG + ++ + A +C + ++ KC+E A Sbjct: 945 AKKEKKAGEKNKLKKKAGKGKKKCKKLGKKSKRAAEKKKCAEAAKKEKEAATKKKCEERA 1004 Query: 261 EAKHPKSDLVQCFPHLKQ 314 + + ++ QC K+ Sbjct: 1005 KKQKEAAEKKQCEERAKK 1022
>HD2C_ARATH (Q9LZR5) Histone deacetylase 2c (HD-tuins protein 3)| Length = 294 Score = 29.6 bits (65), Expect = 6.0 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +3 Query: 108 SKMARERNLEKLKGGKGSQLEANKKAMNIQCKICMQTFICTTSEAKCKEHAEAKH 272 SK A + + G Q + K A CK C +TF TSE + H +AKH Sbjct: 239 SKQAGKNSGGGSTGETSKQQQTPKSAGAFGCKSCTRTF---TSEMGLQSHTKAKH 290
>SNUT1_HUMAN (O43290) U4/U6.U5 tri-snRNP-associated protein 1 (U4/U6.U5| tri-snRNP-associated 110 kDa protein) (Squamous cell carcinoma antigen recognized by T cells 1) (SART-1) (hSART-1) (hSnu66) Length = 800 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 24 PPNFRRTXKVSSRLAEESTAMGGGNAQKSKMARERNLEKLKGGKGSQLEA 173 PP R K R S GG ++ K +RER E+ G +G++ EA Sbjct: 29 PPRHREHKKHKHR----SGGSGGSGGERRKRSRERGGERGSGRRGAEAEA 74
>CT129_HUMAN (Q9H4H8) Protein C20orf129| Length = 585 Score = 29.3 bits (64), Expect = 7.8 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 3 ASCFSP-SPPNFRRTXKVSSRLAEESTAMGGGNAQKSKMARER 128 A+C SP PPN S RLA E GG A + + RER Sbjct: 13 AACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRER 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,480,404 Number of Sequences: 219361 Number of extensions: 1190054 Number of successful extensions: 3631 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3630 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)