| Clone Name | basd14j13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAB36_HUMAN (O95755) Ras-related protein Rab-36 | 30 | 2.8 | 2 | E41L3_MOUSE (Q9WV92) Band 4.1-like protein 3 (4.1B) (Differentia... | 29 | 8.1 | 3 | E41L3_HUMAN (Q9Y2J2) Band 4.1-like protein 3 (4.1B) (Differentia... | 29 | 8.1 |
|---|
>RAB36_HUMAN (O95755) Ras-related protein Rab-36| Length = 333 Score = 30.4 bits (67), Expect = 2.8 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 305 SWTLGRVGRSASRRAPTYSTLRPASRS 385 SW LGR S ++ PT ST+R A RS Sbjct: 7 SWMLGRAAASPTQTPPTTSTIRVARRS 33
>E41L3_MOUSE (Q9WV92) Band 4.1-like protein 3 (4.1B) (Differentially expressed| in adenocarcinoma of the lung protein 1) (DAL-1) (DAL1P) (mDAL-1) Length = 929 Score = 28.9 bits (63), Expect = 8.1 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -1 Query: 451 CFEHSNFFKVTMPKTRPGQ-LRLGARCRPKGR 359 C EH FF++ +P+ P + L LG++ R GR Sbjct: 388 CVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGR 419
>E41L3_HUMAN (Q9Y2J2) Band 4.1-like protein 3 (4.1B) (Differentially expressed| in adenocarcinoma of the lung protein 1) (DAL-1) Length = 1087 Score = 28.9 bits (63), Expect = 8.1 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -1 Query: 451 CFEHSNFFKVTMPKTRPGQ-LRLGARCRPKGR 359 C EH FF++ +P+ P + L LG++ R GR Sbjct: 380 CVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGR 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,053,963 Number of Sequences: 219361 Number of extensions: 1338447 Number of successful extensions: 3231 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3230 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)