| Clone Name | basd14i10 |
|---|---|
| Clone Library Name | barley_pub |
>OMP19_RHILO (Q98EC1) Outer membrane lipoprotein omp19 homolog precursor| Length = 179 Score = 32.0 bits (71), Expect = 1.2 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -1 Query: 177 PGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVVSGR 19 P +P S P P P+ T VA P G + S +G W A VSG+ Sbjct: 53 PASPGSTDPSKFPTAPANTQVASLPPDGQAPAGASDLSAAAVAGVWNASVSGQ 105
>IBP1_MOUSE (P47876) Insulin-like growth factor-binding protein 1 precursor| (IGFBP-1) (IBP-1) (IGF-binding protein 1) Length = 272 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -1 Query: 183 CSPGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVVSGR 19 C+P ++ R GL P P+ + + PAGC CC L GA C V + R Sbjct: 32 CAPC--TAERLGLCPPVPA-SCPEISRPAGCGCCPTCA----LPMGAACGVATAR 79
>BRCA2_RAT (O35923) Breast cancer type 2 susceptibility protein homolog (Fanconi| anemia group D1 protein homolog) Length = 3343 Score = 30.4 bits (67), Expect = 3.5 Identities = 20/68 (29%), Positives = 25/68 (36%), Gaps = 14/68 (20%) Frame = -1 Query: 186 WCSPGAPSSRRP--------------GLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLAS 49 W +P +R P G PR + P SCC+P+G PLA Sbjct: 3118 WSTPNKDPTREPYPASTCSASDLASGGQLPRSSPTDQQSYRSPL--SCCTPTGKSTPLAH 3175 Query: 48 GAWCAVVS 25 AW A S Sbjct: 3176 SAWMAAKS 3183
>WNT9B_MOUSE (O35468) Protein Wnt-9b precursor (Wnt-15) (Wnt-14b)| Length = 359 Score = 30.0 bits (66), Expect = 4.6 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = -1 Query: 192 WIWCSPGAPSSRRPGLAPRPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCA 34 W PG P+ GLAPRP G LV +E+ S C PS Y P +G C+ Sbjct: 264 WAPAKPGGPAK---GLAPRP--GDLVYMEDSP--SFCRPSKY-SPGTAGRVCS 308
>AUXI_BOVIN (Q27974) Auxilin| Length = 910 Score = 29.6 bits (65), Expect = 6.0 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 504 YTPIITHDEVHEYRTGHG--YMNISHTHTGRQVLIMYHLRST 385 YT + + EYR G ++ +S T G V+ MYHLRST Sbjct: 262 YTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHLRST 303
>VGLL2_MOUSE (Q8BGW8) Transcription cofactor vestigial-like protein 2 (Vgl-2)| (VITO1 protein) Length = 322 Score = 29.3 bits (64), Expect = 7.8 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = -1 Query: 174 GAPSSRRPGLAPRP--PSGTLVAVEEPAGCSCCSPSG-YVRP---LASGAWCAVVSGRR 16 G P P AP P P L A EPAG + +P G +V P +A +V SG+R Sbjct: 246 GRPGRLAPASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDSGKR 304
>XKR4_PANTR (Q49LS4) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 150 GLAPRPPSGTLVAVEEPAGCSCCSPSG 70 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>XKR4_HUMAN (Q5GH76) XK-related protein 4| Length = 650 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 150 GLAPRPPSGTLVAVEEPAGCSCCSPSG 70 GLAP PSG+ EE AG CC G Sbjct: 33 GLAPGLPSGSGAEDEEAAGGGCCPDGG 59
>ACVL1_RAT (P80203) Serine/threonine-protein kinase receptor R3 precursor (EC| 2.7.11.30) (SKR3) (TGF-B superfamily receptor type I) (TSR-I) Length = 504 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -1 Query: 138 RPPSGTLVAVEEPAGCSCCSPSGYVRPLASGAWCAVVSGRRDPR 7 +P G LV C+C +P RP+ GAWC VV R R Sbjct: 26 KPSRGQLV------NCTCENPH-CKRPICQGAWCTVVLVREQGR 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,274,500 Number of Sequences: 219361 Number of extensions: 1464573 Number of successful extensions: 4691 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4687 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)