| Clone Name | basd14e16 |
|---|---|
| Clone Library Name | barley_pub |
>PSBR_HORVU (Q40070) Photosystem II 10 kDa polypeptide, chloroplast precursor| Length = 138 Score = 54.3 bits (129), Expect = 3e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 526 KGVYQFVDKYGANVDGYSPIYTPE 597 KGVYQF DKYGANVDGYSPIYTPE Sbjct: 73 KGVYQFADKYGANVDGYSPIYTPE 96
>PSBR_SPIOL (P10690) Photosystem II 10 kDa polypeptide, chloroplast precursor| Length = 140 Score = 50.8 bits (120), Expect = 3e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 526 KGVYQFVDKYGANVDGYSPIYTPE 597 KGVYQFVDKYGANVDGYSPIY E Sbjct: 75 KGVYQFVDKYGANVDGYSPIYNEE 98
>PSBR_TOBAC (Q40519) Photosystem II 10 kDa polypeptide, chloroplast precursor| (PII10) Length = 136 Score = 49.7 bits (117), Expect = 6e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 526 KGVYQFVDKYGANVDGYSPIYTPE 597 KGVYQFVDKYGANVDGYSPIY + Sbjct: 71 KGVYQFVDKYGANVDGYSPIYNTD 94
>PSBR_SOLTU (P06183) Photosystem II 10 kDa polypeptide, chloroplast precursor| (Light-inducible tissue-specific ST-LS1 protein) Length = 138 Score = 48.5 bits (114), Expect = 1e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 526 KGVYQFVDKYGANVDGYSPIYTPE 597 KGVYQ+VDKYGANVDGYSPIY + Sbjct: 73 KGVYQYVDKYGANVDGYSPIYNTD 96
>PSBR_LYCES (Q40163) Photosystem II 10 kDa polypeptide, chloroplast precursor| Length = 138 Score = 48.5 bits (114), Expect = 1e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 526 KGVYQFVDKYGANVDGYSPIYTPE 597 KGVYQ+VDKYGANVDGYSPIY + Sbjct: 73 KGVYQYVDKYGANVDGYSPIYNTD 96
>PSBR_BRACM (P49108) Photosystem II 10 kDa polypeptide, chloroplast precursor| Length = 141 Score = 46.2 bits (108), Expect = 7e-05 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +1 Query: 529 GVYQFVDKYGANVDGYSPIYTPE 597 GVY+FVDKYGANVDGYSPIY + Sbjct: 77 GVYKFVDKYGANVDGYSPIYNED 99
>PSBR_ARATH (P27202) Photosystem II 10 kDa polypeptide, chloroplast precursor| Length = 140 Score = 44.7 bits (104), Expect = 2e-04 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +1 Query: 529 GVYQFVDKYGANVDGYSPIY 588 GVY++VDKYGANVDGYSPIY Sbjct: 76 GVYKYVDKYGANVDGYSPIY 95
>RNH1_CRIFA (Q07762) Ribonuclease H (EC 3.1.26.4) (RNase H)| Length = 494 Score = 32.7 bits (73), Expect = 0.82 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +1 Query: 403 SDTVLVSTINDADQGSADVAYRTPPAPYEKSSFAVVCSGGKKGVYQFVDKYGANVDGYS 579 S V V+ G + PPA K SF VV G ++G+Y D+ V G+S Sbjct: 124 SQKVGVAPTTSRASGETRTSCAPPPASRMKPSFYVVAVGRQRGIYSTWDQCSEQVKGFS 182
>MIM1_CHICK (P08940) Myeloid protein 1 precursor (p33)| Length = 326 Score = 30.4 bits (67), Expect = 4.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 469 TPPAPYEKSSFAVVCSGGKKGVYQFVDKYGANVDG 573 +PP P + + +AVVC+G + DKYG G Sbjct: 172 SPPFPQQDAHWAVVCAGNPTNEIRGCDKYGCGYFG 206
>RAB36_HUMAN (O95755) Ras-related protein Rab-36| Length = 333 Score = 30.4 bits (67), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 33 SWTLGRVGRSASRRAPTYSTLRPASRS 113 SW LGR S ++ PT ST+R A RS Sbjct: 7 SWMLGRAAASPTQTPPTTSTIRVARRS 33
>CY552_THIFE (P74917) Cytochrome c-552 precursor (Cytochrome c552)| Length = 230 Score = 30.0 bits (66), Expect = 5.3 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +1 Query: 436 ADQGSADVAYRTPPAPYEKSSFAVVCSG--GKKGVYQFVDKYGANVDGY 576 A Q SA V PAPY SS +VC G G+ +Y V + Y Sbjct: 41 AGQASAAVGSADAPAPYRVSSDCMVCHGMTGRDTLYPIVPRLAGQHKSY 89
>CP1A1_RABIT (P05176) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) (P450 isozyme| 6) (P-450 PHPAH1) (P450 LM6) Length = 518 Score = 29.6 bits (65), Expect = 6.9 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = -1 Query: 254 RSRRPTQ*DRNPMMLSHANVSRAMACFEHSNFFKVTMPKTRPGQLRLGARCRPKGR 87 R+RRP DR + A + M F H++F T+P + LG PKGR Sbjct: 357 RARRPRFSDRPQLPYLEAVI---METFRHTSFLPFTIPHSTTRDTSLGGFYIPKGR 409
>NEU1_CATCO (P15210) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 154 Score = 29.3 bits (64), Expect = 9.1 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 345 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 461 S+C C+ S +GG + I+ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAIQDSPSRQCMSCGPGDRGRC 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,286,903 Number of Sequences: 219361 Number of extensions: 1778008 Number of successful extensions: 4299 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 4163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4298 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)