| Clone Name | basd13m24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLAF1_CANFA (Q95MM9) Signaling lymphocytic activation molecule p... | 36 | 0.066 | 2 | MCP_HUMAN (P15529) Membrane cofactor protein precursor (Trophobl... | 30 | 3.6 | 3 | LAMA_DROME (Q00174) Laminin alpha chain precursor | 30 | 3.6 |
|---|
>SLAF1_CANFA (Q95MM9) Signaling lymphocytic activation molecule precursor (CD150| antigen homolog) Length = 342 Score = 36.2 bits (82), Expect = 0.066 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 441 ESSVPH-WAIYA-LCISGALGLVVIASIVYLLLSRRKKDNTVIP 566 ESSVP W +YA L + G +G+++I +V LLL RR K N P Sbjct: 231 ESSVPRQWRLYAGLFLGGIVGVILIFEVVLLLLRRRGKTNHYKP 274
>MCP_HUMAN (P15529) Membrane cofactor protein precursor (Trophoblast leukocyte| common antigen) (TLX) (CD46 antigen) Length = 392 Score = 30.4 bits (67), Expect = 3.6 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 420 YSQPETNE-SSVPHWAIYALCISGALGLVVIASIVYLLLSRRKKDNTVI 563 Y +PE S+ W I + I+ +G+ VI + Y L RRKK T + Sbjct: 331 YPKPEEGILDSLDVWVIAVIVIAIVVGVAVICVVPYRYLQRRKKKGTYL 379
>LAMA_DROME (Q00174) Laminin alpha chain precursor| Length = 3712 Score = 30.4 bits (67), Expect = 3.6 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 120 MSFRQERPSGSLWNLGEKKAFGAAATSLVKGNPSTEI--PNELQERIMISEVLTDG 281 +SFR ERP+G L G K+ A L+ G + EI +LQ +I L DG Sbjct: 3377 ISFRTERPNGLLIYAGSKQRDDFIAVYLLDGRVTYEIRVGAQLQAKITTEAELNDG 3432 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,799,254 Number of Sequences: 219361 Number of extensions: 1497829 Number of successful extensions: 3698 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3695 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)