| Clone Name | basd13m18 |
|---|---|
| Clone Library Name | barley_pub |
>DOC2B_RAT (P70610) Double C2-like domain-containing protein beta (Doc2-beta)| Length = 412 Score = 31.2 bits (69), Expect = 1.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = -3 Query: 516 ISLHLMP--FKRDKSITRTLKRTMNLSYMEA*EXLGKISGNIYRKRLYLSI 370 + LHL+P K +K T+TL+ T+N S+ E G ++ RK L +S+ Sbjct: 166 VKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMIRKTLRISV 216
>DOC2B_MOUSE (P70169) Double C2-like domain-containing protein beta (Doc2-beta)| Length = 412 Score = 31.2 bits (69), Expect = 1.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = -3 Query: 516 ISLHLMP--FKRDKSITRTLKRTMNLSYMEA*EXLGKISGNIYRKRLYLSI 370 + LHL+P K +K T+TL+ T+N S+ E G ++ RK L +S+ Sbjct: 166 VKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISV 216
>HIS2_METKA (P58835) Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (PRA-PH)| Length = 100 Score = 30.4 bits (67), Expect = 3.1 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +1 Query: 307 NVFCTKFIEETSDEVLV*EAGDAEVQPFPVYVSTNL------SQXFLGFHVGEVHCSFQ 465 N C K IEE+ + +L + GD E VY ST+L +LG +GEV F+ Sbjct: 41 NKICEKIIEESGELILAAKDGDRE---GVVYESTDLIFHVLVLLAYLGIEIGEVFDEFE 96
>DOC2B_HUMAN (Q14184) Double C2-like domain-containing protein beta (Doc2-beta)| Length = 412 Score = 30.0 bits (66), Expect = 4.1 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = -3 Query: 516 ISLHLMP--FKRDKSITRTLKRTMNLSYMEA*EXLGKISGNIYRKRLYLSI 370 + LHL+P K +K T+TL+ T+N ++ E G ++ RK L +S+ Sbjct: 166 VKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISV 216
>WDTC1_MOUSE (Q80ZK9) WD and tetratricopeptide repeats protein 1| Length = 677 Score = 30.0 bits (66), Expect = 4.1 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 265 NHEVLHKIDIDHLENVFCTKFIEETSDEVLV*EAGDAEVQPFPVYVSTNLSQXFLGFHVG 444 +H+ L + H N+F KF+ D +L+ A D++V + V + G H Sbjct: 78 HHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETI--HMFGDHTN 135 Query: 445 EV 450 V Sbjct: 136 RV 137
>WDTC1_HUMAN (Q8N5D0) WD and tetratricopeptide repeats protein 1| Length = 677 Score = 30.0 bits (66), Expect = 4.1 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 265 NHEVLHKIDIDHLENVFCTKFIEETSDEVLV*EAGDAEVQPFPVYVSTNLSQXFLGFHVG 444 +H+ L + H N+F KF+ D +L+ A D++V + V + G H Sbjct: 78 HHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETI--HMFGDHTN 135 Query: 445 EV 450 V Sbjct: 136 RV 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,902,920 Number of Sequences: 219361 Number of extensions: 1374608 Number of successful extensions: 3587 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3587 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)