| Clone Name | basd14b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contain... | 30 | 4.6 | 2 | PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contain... | 30 | 6.0 | 3 | PLMN_PIG (P06867) Plasminogen precursor (EC 3.4.21.7) [Contains:... | 24 | 9.4 |
|---|
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.4 bits (67), Expect = 4.6 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 302 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPILRRW 406 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.0 bits (66), Expect = 6.0 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 302 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 406 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>PLMN_PIG (P06867) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 790 Score = 24.3 bits (51), Expect(2) = 9.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 250 SPPPTSREVH*TLSFRGRRSRNKVSV 327 +PPPTS + L RG R VSV Sbjct: 245 TPPPTSGPTYQCLKGRGENYRGTVSV 270 Score = 23.5 bits (49), Expect(2) = 9.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 320 FP*VNLRKDHCRDPD 364 FP NL +++CR+PD Sbjct: 295 FPCKNLEENYCRNPD 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,236,562 Number of Sequences: 219361 Number of extensions: 1964076 Number of successful extensions: 4482 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4478 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)