| Clone Name | basd13k19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1... | 30 | 4.4 | 2 | NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precu... | 29 | 9.8 | 3 | SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 29 | 9.8 |
|---|
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 30.4 bits (67), Expect = 4.4 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 478 TSKR*AVGRSWESAQRRMSGRTSHGSMVATRRDHRCTAHSIHIIRPPPPKPSAGARSPAP 299 TS R +G+ W+S + S R S RR + S PPPP P RSP P Sbjct: 538 TSPRMQMGKRWQSPVTKSSRRRRSPSPPPARRRR---SPSPAPPPPPPPPPPRRRRSPTP 594
>NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)] Length = 868 Score = 29.3 bits (64), Expect = 9.8 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -2 Query: 430 RMSGRTSHGSMVATRRDHRCTAHSIHIIRP-----PPPKPSAGARSPA 302 R S R+S GS T ++S I RP P P+P RSPA Sbjct: 46 RSSSRSSRGSTTTTSSSENSGSNSGSIFRPAAPPEPRPQPQPQPRSPA 93
>SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) (p150) (Fragment) Length = 1324 Score = 29.3 bits (64), Expect = 9.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 403 SMVATRRDHRCTAHSIHIIRPPPPKPSAGARSPAP 299 ++ AT+ + ++ ++ RPPPP+P A PAP Sbjct: 1088 TLPATQLQQKDSSQTLEPKRPPPPRPVAPPARPAP 1122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,207,426 Number of Sequences: 219361 Number of extensions: 696603 Number of successful extensions: 3898 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3847 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)