| Clone Name | basd13k17 |
|---|---|
| Clone Library Name | barley_pub |
>HOW_DROME (O01367) Protein held out wings (KH-domain protein KH93F) (Putative| RNA-binding protein) (Protein muscle-specific) (Protein wings held out) (Protein struthio) (Quaking-related 93F) Length = 405 Score = 35.4 bits (80), Expect = 0.11 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +2 Query: 197 SSAAVADQEKYLAELLAERHKLNPFVPVLPHSIRLLNQEILRVSTLLENASLLNQSGFEH 376 S+ ++AD YLA+LL +R +L F V H RLL++EI RV ASL +G + Sbjct: 71 STQSIAD---YLAQLLKDRKQLAAFPNVFTHVERLLDEEIARV-----RASLFQINGVKK 122 Query: 377 GSPLT 391 PLT Sbjct: 123 -EPLT 126
>KHDR3_HUMAN (O75525) KH domain-containing, RNA binding, signal| transduction-associated protein 3 (Sam68-like mammalian protein 2) (SLM-2) (Sam68-like phosphotyrosine protein) (RNA-binding protein T-Star) Length = 346 Score = 35.0 bits (79), Expect = 0.14 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +2 Query: 218 QEKYLAELLAERHKLNPFVPVLPHSIRLLNQEI 316 +EKYL EL+AE+ L+ P H++RL+NQEI Sbjct: 2 EEKYLPELMAEKDSLD---PSFTHALRLVNQEI 31
>KHDR3_RAT (Q9JLP1) KH domain-containing, RNA binding, signal| transduction-associated protein 3 (Sam68-like mammalian protein 2) (SLM-2) (rSLM-2) Length = 346 Score = 33.5 bits (75), Expect = 0.41 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 218 QEKYLAELLAERHKLNPFVPVLPHSIRLLNQEI 316 +EKYL EL+AE+ L+ P H++RL+N+EI Sbjct: 2 EEKYLPELMAEKDSLD---PSFTHALRLVNREI 31
>KHDR3_MOUSE (Q9R226) KH domain-containing, RNA binding, signal| transduction-associated protein 3 (Sam68-like mammalian protein 2) (SLM-2) (RNA-binding protein Etoile) Length = 346 Score = 33.5 bits (75), Expect = 0.41 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 218 QEKYLAELLAERHKLNPFVPVLPHSIRLLNQEI 316 +EKYL EL+AE+ L+ P H++RL+N+EI Sbjct: 2 EEKYLPELMAEKDSLD---PSFTHALRLVNREI 31
>PURA_PYRSS (Q59726) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 339 Score = 32.3 bits (72), Expect = 0.92 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -2 Query: 383 DYHVQSHFGLKGRRSPIVWKHVKFLDSASGCYEGAPGQTGSACGAPRA 240 D++V+ G+ R + I KH K LD ++G G G TGS CG A Sbjct: 90 DFNVKERVGIDYRCAIIEPKH-KELDRSNGYLHGKIGTTGSGCGPANA 136
>PURA_PYRHO (O58187) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 339 Score = 32.3 bits (72), Expect = 0.92 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = -2 Query: 383 DYHVQSHFGLKGRRSPIVWKHVKFLDSASGCYEGAPGQTGSACGAPRA 240 D++V+ G+ R + I KH K LD +G G G TGS CG A Sbjct: 90 DFNVKDRVGIDYRCAIIEEKH-KQLDRTNGYLHGKIGTTGSGCGPANA 136
>PURA_PYRAB (Q9UYB3) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 339 Score = 30.8 bits (68), Expect = 2.7 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = -2 Query: 383 DYHVQSHFGLKGRRSPIVWKHVKFLDSASGCYEGAPGQTGSACGAPRA 240 +++V+ G+ R + I KH K LD +G G G TGS CG A Sbjct: 90 EFNVKDRVGIDYRCAIIEEKH-KELDRTNGYLHGKIGTTGSGCGPANA 136
>SAM68_RAT (Q91V33) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (p21 Ras GTPase-activating protein-associated p62) (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p68) Length = 443 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/43 (34%), Positives = 28/43 (65%) Frame = +2 Query: 197 SSAAVADQEKYLAELLAERHKLNPFVPVLPHSIRLLNQEILRV 325 ++A + + KYL EL+AE+ L+ P H+++LL+ EI ++ Sbjct: 93 AAAKMEPENKYLPELMAEKDSLD---PSFTHAMQLLSVEIEKI 132
>HEMH_PSEPK (Q88PV4) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 338 Score = 29.6 bits (65), Expect = 6.0 Identities = 19/64 (29%), Positives = 33/64 (51%) Frame = +2 Query: 197 SSAAVADQEKYLAELLAERHKLNPFVPVLPHSIRLLNQEILRVSTLLENASLLNQSGFEH 376 +S +VAD +YL + L ++P+V LP +R L ++ + ++A +E Sbjct: 15 ASTSVADVRRYLNQFL-----MDPYVIDLPWPVRRLLVSLVLIKRPEQSAHAYASIWWEE 69 Query: 377 GSPL 388 GSPL Sbjct: 70 GSPL 73
>SAM68_HUMAN (Q07666) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (p21 Ras GTPase-activating protein-associated p62) (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p68) Length = 443 Score = 29.6 bits (65), Expect = 6.0 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +2 Query: 197 SSAAVADQEKYLAELLAERHKLNPFVPVLPHSIRLLNQEILRV 325 +S + + KYL EL+AE+ L+ P H+++LL EI ++ Sbjct: 93 ASVKMEPENKYLPELMAEKDSLD---PSFTHAMQLLTAEIEKI 132
>KCNK7_MOUSE (Q9Z2T1) Potassium channel subfamily K member 7 (Putative potassium| channel DP3) (Double-pore K(+) channel 3) (Neuromuscular two p domain potassium channel) Length = 307 Score = 29.3 bits (64), Expect = 7.8 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 326 STLLENASLLNQSGFEHGSPLTSGG 400 S LL AS+L +G+ H +PL+SGG Sbjct: 94 SALLFTASILTTTGYGHMAPLSSGG 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,820,231 Number of Sequences: 219361 Number of extensions: 1012104 Number of successful extensions: 3068 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3067 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)