| Clone Name | basd12j07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MDLB_PSEPU (P20932) L(+)-mandelate dehydrogenase (EC 1.-.-.-) (S... | 29 | 3.8 | 2 | SPRT_VIBVY (Q7MHK4) Protein sprT | 28 | 4.9 | 3 | SPRT_VIBVU (Q8DCA5) Protein sprT | 28 | 4.9 |
|---|
>MDLB_PSEPU (P20932) L(+)-mandelate dehydrogenase (EC 1.-.-.-) (S-mandelate| dehydrogenase) (MDH) Length = 393 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 98 ATAKAGVDEAEARMSA*VTKTLVRIQCPENPRFPPQGSSTEG 223 A + GVDE + A + +TL +I CP+ P EG Sbjct: 335 ARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQNEG 376
>SPRT_VIBVY (Q7MHK4) Protein sprT| Length = 168 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 153 VTQADILASASSTPAFAVASL*GGTLPYRC 64 + Q L A++T FAVAS+ G T YRC Sbjct: 100 IMQGVFLLPANTTHQFAVASVQGKTFQYRC 129
>SPRT_VIBVU (Q8DCA5) Protein sprT| Length = 168 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 153 VTQADILASASSTPAFAVASL*GGTLPYRC 64 + Q L A++T FAVAS+ G T YRC Sbjct: 100 IMQGVFLLPANTTHQFAVASVQGKTFQYRC 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,344,817 Number of Sequences: 219361 Number of extensions: 443055 Number of successful extensions: 1187 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1187 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)