| Clone Name | basd11n19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SNWA_DICDI (P54705) Protein snwA | 31 | 3.2 | 2 | PRKDC_MOUSE (P97313) DNA-dependent protein kinase catalytic subu... | 30 | 9.4 | 3 | KR2_HHV11 (P04290) Probable serine/threonine-protein kinase (EC ... | 30 | 9.4 |
|---|
>SNWA_DICDI (P54705) Protein snwA| Length = 685 Score = 31.2 bits (69), Expect = 3.2 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -3 Query: 696 PSEVKPDEEQCTLYTPKIKPDKLKTRSDRGEES*QKQREPEPRACNRQG 550 P V +EE+ L+ PK KP + K + + +E K ++ P NR+G Sbjct: 11 PKNVYSNEEEDPLFQPKPKPQQQKQQQQQQQELNDKPKKVIPTYGNRKG 59
>PRKDC_MOUSE (P97313) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) (P460) Length = 4128 Score = 29.6 bits (65), Expect = 9.4 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 5/67 (7%) Frame = -3 Query: 663 TLYTP-----KIKPDKLKTRSDRGEES*QKQREPEPRACNRQGGSTG*IPSVQRSSDGNF 499 T+ TP + P L T++ G S Q+Q+ + RA +Q T SV+RSS F Sbjct: 2596 TVLTPMFIETQASPSILHTQTQEGPLSDQRQKPGQVRATQQQYDFTPTQASVERSS---F 2652 Query: 498 CWLTSAT 478 WLT ++ Sbjct: 2653 DWLTGSS 2659
>KR2_HHV11 (P04290) Probable serine/threonine-protein kinase (EC 2.7.11.1)| (Virion protein VMW57) Length = 518 Score = 29.6 bits (65), Expect = 9.4 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 33 PPSRGERSRPPLRRAAAVLTPPPT 104 P + + +RPPLRR+ A LT PP+ Sbjct: 95 PGTAAKLNRPPLRRSQAALTAPPS 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,127,294 Number of Sequences: 219361 Number of extensions: 1989853 Number of successful extensions: 5701 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5694 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)