>NDC1_CAEBR (Q60M68) Nucleoporin ndc-1|
          Length = 587

 Score = 28.9 bits (63), Expect = 5.7
 Identities = 18/67 (26%), Positives = 35/67 (52%)
 Frame = +2

Query: 224 ANKKSKSVGSNYNSCKLLPFGRKFTLSGLGVAVVVTCESATQV*GN*MLYVKSSW*FIAV 403
           +N +  S  +  +  K LP+G     SG+  A+  T   A  V G+ +L+  S+W ++ +
Sbjct: 218 SNVQVNSFKTLIDFAKSLPYGSLAETSGVDAAIAYTAAMALTVFGSPLLWGFSAW-WLLI 276

Query: 404 SHQFKIL 424
           + QF ++
Sbjct: 277 NIQFHLV 283


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,500,673
Number of Sequences: 219361
Number of extensions: 861264
Number of successful extensions: 1654
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1601
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1654
length of database: 80,573,946
effective HSP length: 101
effective length of database: 58,418,485
effective search space used: 2511994855
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)