| Clone Name | basd11j18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | L1CAM_FUGRU (Q98902) Neural cell adhesion molecule L1 precursor ... | 31 | 3.0 | 2 | SYY_LEIXX (Q6AGC2) Tyrosyl-tRNA synthetase (EC 6.1.1.1) (Tyrosin... | 30 | 5.2 | 3 | MYH7_MESAU (P13540) Myosin heavy chain, cardiac muscle beta isof... | 30 | 6.7 |
|---|
>L1CAM_FUGRU (Q98902) Neural cell adhesion molecule L1 precursor (N-CAM L1)| (L1-CAM) Length = 1277 Score = 31.2 bits (69), Expect = 3.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 311 SFYYDQKAIMSNEEFDNLKEELMWEGSSVVMLSAD 415 +F QKA++ E F + K ++ WE SS+ +L AD Sbjct: 454 TFVEGQKALLECETFGSPKPKVTWESSSISLLLAD 488
>SYY_LEIXX (Q6AGC2) Tyrosyl-tRNA synthetase (EC 6.1.1.1) (Tyrosine--tRNA| ligase) (TyrRS) Length = 442 Score = 30.4 bits (67), Expect = 5.2 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +2 Query: 329 KAIMSNEEFDNLKEELMWEGSSVVMLSADEQRLLEASMAYIAGNPIMSDVEFD 487 +A ++ FDN+ +EL+W G +V +S DE L + +AG PI FD Sbjct: 13 RAQSNDPSFDNVWDELIWRG--LVYVSTDEAALKQ----LLAGEPIAYYCGFD 59
>MYH7_MESAU (P13540) Myosin heavy chain, cardiac muscle beta isoform (MyHC-beta)| Length = 1934 Score = 30.0 bits (66), Expect = 6.7 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 13/88 (14%) Frame = +2 Query: 287 QEFLRALQSFYYDQKAIMSNEEFDNLKEELMWEGSSV-------VMLSADEQRL------ 427 +E L L++F + K + EE +L E+L G S+ L A++ L Sbjct: 1488 EESLEHLETFKRENKNLQ--EEISDLTEQLGSTGKSIHELEKIRKQLEAEKMELQSALEE 1545 Query: 428 LEASMAYIAGNPIMSDVEFDELKLRLKQ 511 EAS+ + GN + + +EF+++K +++ Sbjct: 1546 AEASLEHEEGNILRAQLEFNQIKAEIER 1573 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,094,629 Number of Sequences: 219361 Number of extensions: 749392 Number of successful extensions: 2580 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2580 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)