| Clone Name | basd11i04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CH... | 31 | 3.1 | 2 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 30 | 4.0 | 3 | CCSA_PINTH (P41650) Cytochrome c biogenesis protein ccsA | 29 | 8.9 |
|---|
>CLAT_HUMAN (P28329) Choline O-acetyltransferase (EC 2.3.1.6) (CHOACTase)| (Choline acetylase) (ChAT) Length = 748 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 284 ASL*GGTLPYRCILTSHSFGRSLSPVHLQRKGARSVSYYALFKGWLLLGKPPGCLCTPTS 105 ASL G L Y+ +L SHS + L + YY LF + L G L S Sbjct: 236 ASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNS 295 Query: 104 FI 99 I Sbjct: 296 SI 297
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 30.4 bits (67), Expect = 4.0 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 355 IQCPENPRFPPQGSSTEGESGPK 423 +Q E PR PPQ +T GE GP+ Sbjct: 67 VQLEEEPRGPPQREATPGEPGPR 89
>CCSA_PINTH (P41650) Cytochrome c biogenesis protein ccsA| Length = 320 Score = 29.3 bits (64), Expect = 8.9 Identities = 31/97 (31%), Positives = 39/97 (40%) Frame = -3 Query: 344 VFVTQADILASASSTPAFAVASL*GGTLPYRCILTSHSFGRSLSPVHLQRKGARSVSYYA 165 +F+T ILA S + V + GTL YR S S G+ + L G Sbjct: 2 IFITLEHILAHISFSLILVVTLIYWGTLVYRIEGLSSSGGKGMIVTFLCTTG-------L 54 Query: 164 LFKGWLLLGKPPGCLCTPTSFITERSFRGLSW*SGLF 54 L WL G P S + E SF LSW S +F Sbjct: 55 LINRWLYSGH------LPLSNLYE-SFMFLSWSSSVF 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,234,229 Number of Sequences: 219361 Number of extensions: 1786741 Number of successful extensions: 4404 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4404 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)