ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basd11d10 |
|---|---|
| Clone Library Name | barley_pub |
>LEU1_RHILO (Q98HN3) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 558 Score = 30.0 bits (66), Expect = 1.5 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = +3 Query: 15 QMSIAEGAMQHLYSLQFICADISGVHEDAI--------KRLVSLKEITLAPSVDADTRRS 170 Q+ I E +H Y + + SG H+DAI K SL E+ P AD RS Sbjct: 314 QLKIPE---RHPYVGELVYTAFSGSHQDAINKGMKALKKANTSLWEVPYLPIDPADVGRS 370 Query: 171 WEAAVK 188 +EA ++ Sbjct: 371 YEAIIR 376
>TBB2_SUIBO (Q8J1R4) Tubulin beta-2 chain (Beta-2 tubulin)| Length = 445 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 149 NRWSKGYFLETHETFDRIFMNTADVC--TNKLKRVEMLHS 36 N W+KGY+ E E D I C T L+ +M+HS Sbjct: 103 NNWAKGYYTEGAELIDGILDIVRRQCEATEALQGFQMIHS 142
>TTC8_HUMAN (Q8TAM2) Tetratricopeptide repeat protein 8 (TPR repeat protein 8)| (Bardet-Biedl syndrome 8 protein) Length = 531 Score = 28.1 bits (61), Expect = 5.6 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 11/60 (18%) Frame = -1 Query: 336 FYTQTLKDKNT---TVAVILPNHDVS--------FYRFLTLENILEDGGFNS*LLACFYA 190 +Y + LK NT +A I NH S FYR L I FN+ L CFYA Sbjct: 330 YYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYA 389
>LEU1_BRUSU (Q8FZC4) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 555 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = +3 Query: 15 QMSIAEGAMQHLYSLQFICADISGVHEDAIKRLVSLK--------EITLAPSVDADTRRS 170 Q+ IAE +H Y + + SG H+DAI + + + E+ P D RS Sbjct: 314 QLKIAE---RHPYVGELVYTAFSGSHQDAINKGMKARRSANSPVWEVPYLPIDPQDVGRS 370 Query: 171 WEAAVK 188 +EA ++ Sbjct: 371 YEAIIR 376
>LEU1_BRUME (Q8YIJ3) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 555 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = +3 Query: 15 QMSIAEGAMQHLYSLQFICADISGVHEDAIKRLVSLK--------EITLAPSVDADTRRS 170 Q+ IAE +H Y + + SG H+DAI + + + E+ P D RS Sbjct: 314 QLKIAE---RHPYVGELVYTAFSGSHQDAINKGMKARRSANSPVWEVPYLPIDPQDVGRS 370 Query: 171 WEAAVK 188 +EA ++ Sbjct: 371 YEAIIR 376
>PGS1_SHEEP (O46390) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 114 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 147
>PGS1_RAT (P47853) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 114 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 147
>PGS1_MOUSE (P28653) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 369 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 114 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 147
>PGS1_HUMAN (P21810) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 368 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 113 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 146
>PGS1_BOVIN (P21809) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| (Leucine-rich PG I) Length = 369 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 114 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 147
>PGS1_HORSE (O46403) Biglycan precursor (Bone/cartilage proteoglycan I) (PG-S1)| Length = 372 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 39 MQHLYSLQFICADISGVHEDAIKRLVSLKEITLA 140 +QHLY+L + IS +HE A L L+++ ++ Sbjct: 117 LQHLYALVLVNNKISKIHEKAFSPLRKLQKLYIS 150
>LEU1_PSESM (Q886Y1) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 556 Score = 27.3 bits (59), Expect = 9.6 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = +3 Query: 42 QHLYSLQFICADISGVHEDAIKRLVS------LKEITLAPSVDADTRRSWEAAVK 188 +H Y + SG H+DAI++ + L E+ P AD RS+EA ++ Sbjct: 324 RHPYVGDLVHTAFSGSHQDAIRKGFTQQKEGELWEVPYLPIDPADIGRSYEAVIR 378
>LEU1_PSEPK (Q88P28) 2-isopropylmalate synthase (EC 2.3.3.13)| (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 557 Score = 27.3 bits (59), Expect = 9.6 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = +3 Query: 42 QHLYSLQFICADISGVHEDAIKRLVS------LKEITLAPSVDADTRRSWEAAVK 188 +H Y + SG H+DAI++ + L E+ P AD RS+EA ++ Sbjct: 324 RHPYVGDLVHTAFSGSHQDAIRKGFAKQQDGELWEVPYLPIDPADIGRSYEAVIR 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,835,687 Number of Sequences: 219361 Number of extensions: 810505 Number of successful extensions: 2234 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2234 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
