| Clone Name | basd11c15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR... | 30 | 4.1 | 2 | HYBB_ECOLI (P37180) Probable Ni/Fe-hydrogenase 2 b-type cytochro... | 30 | 5.3 | 3 | ASSY_HAEIN (P44315) Argininosuccinate synthase (EC 6.3.4.5) (Cit... | 29 | 9.1 |
|---|
>VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR6) (Epidermal| growth factor receptor-like protein 6) (AtELP6) (BP80-like protein d) (AtBP80d) Length = 622 Score = 30.4 bits (67), Expect = 4.1 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 293 SILSPSVRACRRDGARLNFDATVWWMYGVGSSI-SGWTAFKCNPGAR*VLPRLQPPSVSS 469 +IL+P + D A NF + Y +GS + +G A+ C+ + P+ P++ Sbjct: 35 TILNPLAMRSKHDAAIANFGVPNYGGYMIGSVVYAGQGAYGCDSFDKTFKPKFPRPTILI 94 Query: 470 IXXXXXYFGYSLGHGR 517 I YF + +G+ Sbjct: 95 IDRGECYFALKVWNGQ 110
>HYBB_ECOLI (P37180) Probable Ni/Fe-hydrogenase 2 b-type cytochrome subunit| Length = 392 Score = 30.0 bits (66), Expect = 5.3 Identities = 23/82 (28%), Positives = 34/82 (41%) Frame = +2 Query: 332 GARLNFDATVWWMYGVGSSISGWTAFKCNPGAR*VLPRLQPPSVSSIXXXXXYFGYSLGH 511 G + FD + + G W + N G P ++P ++S+ FGYSLG Sbjct: 52 GVWIAFDLLIGTGFACGGWALAWAVYVFNRGQ--YHPLVRPALLASL------FGYSLGG 103 Query: 512 GRGYIDVVLVWLMLYALLMHHF 577 IDV W + Y + HF Sbjct: 104 LSITIDVGRYWNLPYFYIPGHF 125
>ASSY_HAEIN (P44315) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 444 Score = 29.3 bits (64), Expect = 9.1 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 334 CKAQLRRDGVVDVRCRKQHLRLDGVQVQPRRPLSTASATTSL 459 C+AQL +G+ ++C H+ G+ PL A T L Sbjct: 74 CRAQLAHEGIAAIQCGAFHISTGGIPYFNTTPLGRAVTGTML 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,765,391 Number of Sequences: 219361 Number of extensions: 1436728 Number of successful extensions: 3095 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3095 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)