| Clone Name | basd11a16 |
|---|---|
| Clone Library Name | barley_pub |
>MOAC_STAS1 (Q49ZJ2) Molybdenum cofactor biosynthesis protein C| Length = 162 Score = 32.0 bits (71), Expect = 1.1 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +1 Query: 253 AKSLAVVVP*CTKLPSATALKTFDQLEAQRSFLLHIQT 366 AK+ A ++P C +LP TFD E ++S+ L+IQT Sbjct: 66 AKNTADIIPMCHQLPLTGIDVTFDWQENEQSYTLNIQT 103
>PLSI_HUMAN (Q14651) Plastin-1 (I-plastin) (Intestine-specific plastin)| Length = 629 Score = 31.6 bits (70), Expect = 1.5 Identities = 20/62 (32%), Positives = 32/62 (51%) Frame = -1 Query: 498 NWSIIVKQQAREIGGRKESE*NCIKILNYGKGKAKNDIRMASSRSLNMQQKTSLRLQLVE 319 NWS + K +GG + NC + GK KAK + + + LN ++ ++L L LV Sbjct: 439 NWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLN-ERNSTLTLALVW 497 Query: 318 RL 313 +L Sbjct: 498 QL 499
>NUMA1_HUMAN (Q14980) Nuclear mitotic apparatus protein 1 (NuMA protein) (SP-H| antigen) Length = 2115 Score = 30.4 bits (67), Expect = 3.3 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = -1 Query: 540 QKAEQRGTEGERLENWSIIVKQQAREIGGRKESE*NCIKILNYGKGKAKNDIRM--ASSR 367 ++AEQ G E ERL + + Q +E G++E E + L +G+A+ D+ + A+ Sbjct: 972 REAEQMGNELERLRAALMESQGQQQEERGQQERE---VARLTQERGRAQADLALEKAARA 1028 Query: 366 SLNMQQKTSLRLQLVE 319 L M+ + +L Q VE Sbjct: 1029 ELEMRLQNALNEQRVE 1044
>ARGC2_DEIRA (Q9RY72) N-acetyl-gamma-glutamyl-phosphate reductase 2 (EC| 1.2.1.38) (AGPR 2) (N-acetyl-glutamate semialdehyde dehydrogenase 2) (NAGSA dehydrogenase 2) Length = 306 Score = 30.0 bits (66), Expect = 4.4 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 343 SFLLHIQTARRSHPDIVFGFP 405 S LL TA R HPD VFGFP Sbjct: 76 SRLLDASTAHRIHPDWVFGFP 96
>RS10_CHLPN (Q9Z803) 30S ribosomal protein S10| Length = 105 Score = 30.0 bits (66), Expect = 4.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 310 LKTFDQLEAQRSFLLHIQTARRSHPDIVFGFPLPVV*DFYAIL 438 LK FDQ + RS ++TA+R+ +V PLP + Y +L Sbjct: 12 LKGFDQGQLDRSTADIVETAKRTGARVVGPIPLPTKREVYTVL 54
>FETP_PSEPK (Q88R49) Probable Fe(2+) trafficking protein| Length = 90 Score = 29.3 bits (64), Expect = 7.5 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = -3 Query: 490 DYREAASQRDW--WEKRVRIKLH-KNPKLREGESQKRYQ---DGFFAQFEYAAENFFAPP 329 D E SQ+ W W+K + ++ K + E +K Q D FFA EYA + PP Sbjct: 29 DIFEHISQKAWADWQKHQTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPP 88 Query: 328 A 326 A Sbjct: 89 A 89
>SAFB2_MOUSE (Q80YR5) Scaffold attachment factor B2| Length = 991 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = -3 Query: 541 SESRAERNRGRETRELVDYREAASQRDWWEKRVRIK-LHKNPKLREGESQKRYQ 383 S+S+ ++ GRE R+++ + + QR+ +R R + + + + RE E ++R Q Sbjct: 638 SKSQDRKSEGREKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQ 691
>RS10_CHLTR (P0A4A1) 30S ribosomal protein S10| Length = 105 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 310 LKTFDQLEAQRSFLLHIQTARRSHPDIVFGFPLPVV*DFYAIL 438 LK FDQ + +S ++TA+R+ +V PLP + Y +L Sbjct: 12 LKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVL 54
>RS10_CHLMU (P0A4A2) 30S ribosomal protein S10| Length = 105 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 310 LKTFDQLEAQRSFLLHIQTARRSHPDIVFGFPLPVV*DFYAIL 438 LK FDQ + +S ++TA+R+ +V PLP + Y +L Sbjct: 12 LKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVL 54
>ATG9_YEAST (Q12142) Autophagy-related protein 9 (Cytoplasm to vacuole| targeting protein 7) Length = 997 Score = 28.9 bits (63), Expect = 9.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 252 HPLTPLEHSLRVPGKNWYGNPFPSAPTCSGSDLKN 148 H ++P +S R PGKNW N +G D+KN Sbjct: 896 HNISPAIYSTRNPGKNWDNNN-------NGDDIKN 923
>REN3A_HUMAN (Q9H1J1) Regulator of nonsense transcripts 3A (Nonsense mRNA| reducing factor 3A) (Up-frameshift suppressor 3 homolog A) (hUpf3) Length = 476 Score = 28.9 bits (63), Expect = 9.7 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -3 Query: 532 RAERNRGRETRELVDYREAASQRDWWEKRVRIKLHKNPKLRE 407 R E R R E +E Q+ EK VRIKL K P+ E Sbjct: 250 REEEKRRRREEERCKKKETDKQKKIAEKEVRIKLLKKPEKGE 291 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,037,158 Number of Sequences: 219361 Number of extensions: 1238563 Number of successful extensions: 3149 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3149 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)