| Clone Name | basd11a13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUZ2_DROME (P25172) Protein suppressor 2 of zeste (Protein poste... | 32 | 1.8 | 2 | SLBP_DROME (Q9VAN6) Histone RNA hairpin-binding protein (Histone... | 31 | 3.1 | 3 | AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alany... | 29 | 9.1 | 4 | AMOT_HUMAN (Q4VCS5) Angiomotin | 29 | 9.1 |
|---|
>SUZ2_DROME (P25172) Protein suppressor 2 of zeste (Protein posterior sex| combs) Length = 1368 Score = 31.6 bits (70), Expect = 1.8 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +3 Query: 147 CEVLDSFSESVEDLAMISSISLLDSSHQLIQKLYRKCWPSNSNSK---LNMHATAKSGGK 317 C + S S A S+ + SSH+ +K + K P ++N K L+ ++++ GK Sbjct: 471 CSSSTNGSSSSLGTADASTSTSTSSSHRKRKKKHSK-EPKDANGKRKKLHAEISSQTDGK 529 Query: 318 SMRVKMALLKPHATDFKRNH 377 M+VK+ H DFKR+H Sbjct: 530 -MKVKITAKPNHKLDFKRSH 548
>SLBP_DROME (Q9VAN6) Histone RNA hairpin-binding protein (Histone| stem-loop-binding protein) Length = 276 Score = 30.8 bits (68), Expect = 3.1 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = +3 Query: 261 PSNSNSKLNMHATAKSGGKSMRVKMALLKPHATDFKR--NHQAHEEDNVFYKLVYRLPES 434 P++SNS N A A GG + PH+ + K+ N +AH+E+ Y S Sbjct: 132 PNSSNSSANGDAAAPKGGNN---------PHSRNSKKSGNFRAHKEEKRVRHNSYTSSTS 182 Query: 435 LSCLYTSQKP 464 S YT P Sbjct: 183 SSSSYTEADP 192
>AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (Membrane protein p161) (CD13 antigen) Length = 965 Score = 29.3 bits (64), Expect = 9.1 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -2 Query: 336 PSSPSCSYPQISRLHACSVWNLSYLASIFCTVSE*AGGNCQVS*WMR 196 P PSC+ + S + L+Y+ S F +S + Q+ W R Sbjct: 257 PEDPSCTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIGIWAR 303
>AMOT_HUMAN (Q4VCS5) Angiomotin| Length = 1084 Score = 29.3 bits (64), Expect = 9.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 1 APATPSPLPADALQLHLRPTASSSSSTAQVK 93 APA P+P+PA AL P A+ +S+ AQ + Sbjct: 972 APAAPAPVPAPALVPVPAPAAAQASAPAQTQ 1002 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,674,350 Number of Sequences: 219361 Number of extensions: 1504656 Number of successful extensions: 4352 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4350 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)