| Clone Name | basd1o11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CP7A1_RABIT (P51542) Cytochrome P450 7A1 (EC 1.14.13.17) (Choles... | 31 | 2.0 | 2 | GGT1_PIG (P20735) Gamma-glutamyltranspeptidase 1 precursor (EC 2... | 30 | 5.9 | 3 | SWR1_ASHGO (Q759G7) Helicase SWR1 (EC 3.6.1.-) | 29 | 7.8 |
|---|
>CP7A1_RABIT (P51542) Cytochrome P450 7A1 (EC 1.14.13.17) (Cholesterol| 7-alpha-monooxygenase) (CYPVII) (Cholesterol 7-alpha-hydroxylase) Length = 501 Score = 31.2 bits (69), Expect = 2.0 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +2 Query: 149 WTWG------CCLWLLCSSRNKRAAGPP 214 W WG CCLWL+ R +R PP Sbjct: 6 WIWGICLSVCCCLWLILGLRRRRMGEPP 33
>GGT1_PIG (P20735) Gamma-glutamyltranspeptidase 1 precursor (EC 2.3.2.2)| (Gamma-glutamyltransferase 1) (GGT 1) (CD224 antigen) [Contains: Gamma-glutamyltranspeptidase 1 heavy chain; Gamma-glutamyltranspeptidase 1 light chain] Length = 568 Score = 29.6 bits (65), Expect = 5.9 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 12/58 (20%) Frame = +2 Query: 158 GCCLWLLCSSR-----NKRAAGPPDAIR-------TDRDSGFAVSASKAQLLLITSQN 295 G CLWL +S+ RAA DA+R T RD G AV A+ A LL + N Sbjct: 21 GLCLWLPSNSKPHNHVYPRAAVAADALRCSEIGRDTLRDGGSAVDAAIAALLCVGLMN 78
>SWR1_ASHGO (Q759G7) Helicase SWR1 (EC 3.6.1.-)| Length = 1486 Score = 29.3 bits (64), Expect = 7.8 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +2 Query: 374 CTDELLPICHH*---EIKLRFAEFQSVYSVVSNIHHLEMLYFVVLYE*ALDAAVNQQ 535 C +L +C+H E++ F SV+SN HL L L + ALD VN Q Sbjct: 959 CLMQLRKVCNHPDLFEVRPILTSFCMDRSVMSNYAHLNQLVLKNLNKHALDTVVNLQ 1015 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,835,225 Number of Sequences: 219361 Number of extensions: 1492825 Number of successful extensions: 3873 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3870 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)