| Clone Name | basd2c19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PKDRE_HUMAN (Q9NTG1) Polycystic kidney disease and receptor for ... | 32 | 0.83 | 2 | AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-) | 30 | 3.2 |
|---|
>PKDRE_HUMAN (Q9NTG1) Polycystic kidney disease and receptor for egg jelly-related| protein precursor (PKD and REJ homolog) Length = 2253 Score = 31.6 bits (70), Expect = 0.83 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 70 PWHCIYYAWFTSFSSCNNSFWQNLFWHLSAG 162 PW C+Y AWF F++ + S + +F+ L+ G Sbjct: 1573 PWWCVYVAWFLVFATSSISSFFIVFYGLTYG 1603
>AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-)| Length = 1208 Score = 29.6 bits (65), Expect = 3.2 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +1 Query: 163 VKIVMRLTDYFFSDHFIGRISNYLASTMFLTTAS*HLC-FSISCVALAL-LSLGKSGWHR 336 +KI L F D G +S YLAS +LT F+I + L L L L SGW Sbjct: 340 IKIYSHLWCELFGDESPGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWEN 399 Query: 337 LK 342 +K Sbjct: 400 IK 401 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,710,582 Number of Sequences: 219361 Number of extensions: 1054108 Number of successful extensions: 2086 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2085 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)