| Clone Name | basd2c16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POF13_SCHPO (O94334) F-box protein pof13 | 32 | 1.6 | 2 | E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein) | 31 | 2.7 | 3 | YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region | 31 | 3.6 | 4 | YGL2_STRVR (P19435) Hypothetical 23.9 kDa protein in glnII regio... | 30 | 6.1 |
|---|
>POF13_SCHPO (O94334) F-box protein pof13| Length = 396 Score = 32.0 bits (71), Expect = 1.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 422 TLTPVIFGSYLVFRVCLDLVPLAQPAPKQCFTPRCPVNCC 303 TLT ++F+ LD +P P +C RCP+N C Sbjct: 223 TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNAC 262
>E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein)| Length = 598 Score = 31.2 bits (69), Expect = 2.7 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -1 Query: 182 PSFILVMDRSPRFGSISSDNRPIKTRFRYGSGGFRSLNQATAYESPAHSSTGTRSE 15 P F R+P GS + +P++ R + SG L Q S ++S+G+ SE Sbjct: 435 PKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESE 490
>YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region| Length = 154 Score = 30.8 bits (68), Expect = 3.6 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 235 VVVRGEMPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGCASG 363 V+ +G +PL PR W++ + AQQLT ++ G+G +G Sbjct: 82 VLEKGGLPLNPRGEWYTKDTI-AQQLTMRAFMEELRGSGVDTG 123
>YGL2_STRVR (P19435) Hypothetical 23.9 kDa protein in glnII region (ORF2)| Length = 240 Score = 30.0 bits (66), Expect = 6.1 Identities = 18/70 (25%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = +1 Query: 346 AGCASGTKSRQTLNTR-YDPKITGVKVGQXXXXXXASSSRGKQPGSPAKAPK*PLSDKGG 522 +GC G ++ + + P G + G A + G Q PA++ P + GG Sbjct: 96 SGCTVGESAQDSQTAQPSQPAQGGEQAGGGEQAGGAEEAGGAQASQPAESA--PAENAGG 153 Query: 523 GGCKDSQEVC 552 G Q+VC Sbjct: 154 GAAASGQQVC 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,783,528 Number of Sequences: 219361 Number of extensions: 1987908 Number of successful extensions: 4460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4459 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)