| Clone Name | basd2a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAC2_YEAST (P39937) Protein PAC2 | 33 | 0.87 | 2 | Y256_MYCGE (P47498) Hypothetical protein MG256 | 31 | 2.5 | 3 | O1078_RAT (P23265) Olfactory receptor 1078 (Olfactory receptor-l... | 30 | 4.3 |
|---|
>PAC2_YEAST (P39937) Protein PAC2| Length = 518 Score = 32.7 bits (73), Expect = 0.87 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 1/98 (1%) Frame = +1 Query: 172 LVLTHWTGLTGQCH-VSR*KEWQNLKISQNIEHTMWTNMEIFHHIWSNRLRDSSKFQFLQ 348 L L +T + C + K ++L ISQN + W N++ + LR SS + Sbjct: 159 LSLNLFTNINSLCEFIEPLKNLESLNISQNKLLSGWDNLKEYDLSHIKTLRLSSCGLSYK 218 Query: 349 FWGKKLGNFVFRKF*KLHITLSIACSTNIENFQHILPC 462 GK L +F R L ++ + S I+NF++ +PC Sbjct: 219 HIGKLLKSF--RTLKMLDLSYNNLTSAGIQNFENEIPC 254
>Y256_MYCGE (P47498) Hypothetical protein MG256| Length = 256 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 479 QNFNFYNFDPNFTEQEAWHVD*PCDNFQHIGRNRLSYSSKI 601 +N NF NF ++++ V P NFQ + NRL Y SK+ Sbjct: 180 KNRNFVNFFETISKEKTGVVQKPVLNFQRLYVNRLYYQSKL 220
>O1078_RAT (P23265) Olfactory receptor 1078 (Olfactory receptor-like protein| F3) Length = 333 Score = 30.4 bits (67), Expect = 4.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 574 PPNMLKIVTGLVHMPCFLFC 515 PP++L L H+PCF+FC Sbjct: 313 PPSLLHFFLVLCHLPCFIFC 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,871,394 Number of Sequences: 219361 Number of extensions: 1956789 Number of successful extensions: 4923 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4912 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)