| Clone Name | basd1j13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y493_AQUAE (O66783) Hypothetical protein aq_493 | 32 | 0.55 | 2 | FA8_HUMAN (P00451) Coagulation factor VIII precursor (Procoagula... | 30 | 2.1 | 3 | PDXS_METMA (Q8PUA5) Pyridoxal biosynthesis lyase pdxS (EC 4.-.-.-) | 30 | 2.7 | 4 | PDXS_METAC (Q8TQH6) Pyridoxal biosynthesis lyase pdxS (EC 4.-.-.-) | 30 | 2.7 | 5 | SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (S... | 29 | 6.0 |
|---|
>Y493_AQUAE (O66783) Hypothetical protein aq_493| Length = 322 Score = 32.3 bits (72), Expect = 0.55 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +1 Query: 7 VHQGVPSLGNQGKSENGRAPWEGVRGRCRKEW---GIFQARLADAEKKYYL 150 V+QGV +LG GK + G+RG +E GI RL KYYL Sbjct: 125 VNQGVKALGKAGKVVEKTQLYIGLRGELYREGDSKGILSVRLVPDRDKYYL 175
>FA8_HUMAN (P00451) Coagulation factor VIII precursor (Procoagulant component)| (Antihemophilic factor) (AHF) [Contains: Factor VIIIa heavy chain, 200 kDa isoform; Factor VIIIa heavy chain, 92 kDa isoform; Factor VIII B chain; Factor VIIIa light chain] Length = 2351 Score = 30.4 bits (67), Expect = 2.1 Identities = 25/77 (32%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +3 Query: 108 IPGKAGRCREEVLLGSRHHAAEFDFSLEVITRRAGTMLGFCSGNL---ALTCSALLMNSS 278 +P KAG R E L+G HA L V + + T LG SG++ +T S + Sbjct: 2008 LPSKAGIWRVECLIGEHLHAGMSTLFL-VYSNKCQTPLGMASGHIRDFQITASGQYGQWA 2066 Query: 279 CLLV*LKLPGQICTWVT 329 L L G I W T Sbjct: 2067 PKLARLHYSGSINAWST 2083
>PDXS_METMA (Q8PUA5) Pyridoxal biosynthesis lyase pdxS (EC 4.-.-.-)| Length = 301 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 102 GDIPGKAGRCREEVLLGSRHHAAEFDFSLEVITRRAGTMLGFCSGNLALTCSALLM 269 G+I AG+ +EE+++ +R A + +E + ++ F +G +A A LM Sbjct: 176 GEIRALAGKTKEELIMVAREIEAPIELVVETAKMQRLPVVNFAAGGVATPADAALM 231
>PDXS_METAC (Q8TQH6) Pyridoxal biosynthesis lyase pdxS (EC 4.-.-.-)| Length = 301 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 102 GDIPGKAGRCREEVLLGSRHHAAEFDFSLEVITRRAGTMLGFCSGNLALTCSALLM 269 G+I AG+ +EE+++ +R A + +E + ++ F +G +A A LM Sbjct: 176 GEIRALAGKTKEELIMVAREIEAPIELVVETAKMQRLPVVNFAAGGVATPADAALM 231
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 28.9 bits (63), Expect = 6.0 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = +2 Query: 41 ASRRTEEHHGKG*EDGVEKNGGYSRQGWPMPRRSITWIKASRRRIRLQSRSNYTARRN 214 ASR + + GGY R G RS +W + SR R R SRS RR+ Sbjct: 371 ASRTSSSRSSSRSSSRSRRGGGYYRSGRHARSRSRSWSR-SRSRSRRYSRSRSRGRRH 427 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,518,733 Number of Sequences: 219361 Number of extensions: 1294011 Number of successful extensions: 2976 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2975 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)